DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34267 and CG34268

DIOPT Version :9

Sequence 1:NP_001097464.1 Gene:CG34267 / 5740365 FlyBaseID:FBgn0085296 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001097465.1 Gene:CG34268 / 5740141 FlyBaseID:FBgn0085297 Length:83 Species:Drosophila melanogaster


Alignment Length:83 Identity:77/83 - (92%)
Similarity:77/83 - (92%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKS------VPVVQHVPVVKNVPVVQHV 59
            ||||||||||||||||||||||||||||||||||||||||      |||||||||||||||||||
  Fly     1 MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVKHVPVVQHVPVVKNVPVVQHV 65

  Fly    60 PVLKSYAVPTYGHHIYHG 77
            ||||||||||||||||||
  Fly    66 PVLKSYAVPTYGHHIYHG 83



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019670
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.