DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34267 and CG34268

DIOPT Version :10

Sequence 1:NP_001097464.1 Gene:CG34267 / 5740365 FlyBaseID:FBgn0085296 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_001097465.1 Gene:CG34268 / 5740141 FlyBaseID:FBgn0085297 Length:83 Species:Drosophila melanogaster


Alignment Length:83 Identity:77/83 - (92%)
Similarity:77/83 - (92%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKS------VPVVQHVPVVKNVPVVQHV 59
            ||||||||||||||||||||||||||||||||||||||||      |||||||||||||||||||
  Fly     1 MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVKHVPVVQHVPVVKNVPVVQHV 65

  Fly    60 PVLKSYAVPTYGHHIYHG 77
            ||||||||||||||||||
  Fly    66 PVLKSYAVPTYGHHIYHG 83

Return to query results.
Submit another query.