DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34267 and CG13044

DIOPT Version :9

Sequence 1:NP_001097464.1 Gene:CG34267 / 5740365 FlyBaseID:FBgn0085296 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_648867.1 Gene:CG13044 / 39795 FlyBaseID:FBgn0036599 Length:155 Species:Drosophila melanogaster


Alignment Length:84 Identity:34/84 - (40%)
Similarity:46/84 - (54%) Gaps:18/84 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRIIAVIFALVAMAFAAPG--------YIEPSYGVV---PV-AQVVPVVKSVPVV---QHVPVV 50
            ||::. |:.||:|:|.|.||        |..|:...|   || |:|..||||||..   |.:..|
  Fly     1 MFKLF-VLAALLAVAAAKPGHLAAAPLVYSAPATTTVVQEPVLAKVGAVVKSVPTAVSHQSLTQV 64

  Fly    51 KNVPVVQHV--PVLKSYAV 67
            .:.|||:.|  ||:|:.||
  Fly    65 HSTPVVEDVVAPVVKTTAV 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34267NP_001097464.1 None
CG13044NP_648867.1 Retinin_C 36..93 CDD:282395 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.