DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and CYP76C6

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_174633.1 Gene:CYP76C6 / 840263 AraportID:AT1G33720 Length:511 Species:Arabidopsis thaliana


Alignment Length:573 Identity:129/573 - (22%)
Similarity:223/573 - (38%) Gaps:115/573 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ILISYVFLLLKCKQKAFVVIGLLY------QEKKYQCFDQAPGPHPWPIIGNINLLGRFQYNPFY 75
            |:......|:.|    |::..||:      :....|.....|||...||||||:|:|:   ||.:
plant     3 IISGQPLFLIFC----FILSCLLFFTTARSRRSPCQLSKSPPGPPRLPIIGNIHLVGK---NPHH 60

  Fly    76 GFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNK-----NGKYFGGRPDFFRYHKLFGGDRN 135
            .|..|:|.||.:.||.||....:|:.:.|.::|||..     :|:|.........:|:...|   
plant    61 SFTDLSKTYGPVMSLKLGCLNSVVIASRDAVREVLKTHDQILSGRYISEATKSNNHHEFSVG--- 122

  Fly   136 NSLALCDWSQLQQKRRNLARR---------HCSPRESSSYFSKMSEIGGLEVNQLLDQLTNISSG 191
                   |......|..:.|:         .|.....:....|:.|:    ||.|.:......: 
plant   123 -------WIHPSSSRFRMLRKLSATQLFSPQCIQATKALRMKKVQEL----VNFLSESCEREEA- 175

  Fly   192 YPCDVKPLILAASANMFCQYMCSVRF-NYSDK---GFQKIIEYFDEIFWEINQGYSFDYIPWLVP 252
              .|:..:....:.|:....:.||.. :|..|   .||:::..:.|   .|......::.|::..
plant   176 --VDISHVSFVTALNIISNILFSVNLGSYDSKNSSAFQEMVIGYQE---SIGNPDLANFFPFMRF 235

  Fly   253 FYCNHISRIVHWSAS-----IRKFILERIVNHRESNININEPDKDFTDALLKSLKEDK-NVSRNT 311
            ......|:.:..|:.     .|:|...|||.....::..:...|||.|.|:...:.|: .::.:.
plant   236 LDLQGNSKKMRESSGRLLQVFREFYDARIVEKSSRSVEKDVSSKDFLDVLIDLQQGDETEINIDE 300

  Fly   312 IIFMLED-FIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDMNVMPYTMA 375
            |..:|.| |:.|.....:.|..|:|.:..||.....:::|::.|..:. ......|::.:||..|
plant   301 IEHLLLDMFVAGTDTNSSTVEWAMAELLGNPKTMTKVQDEINHVIGQN-GDFQESDISKLPYLKA 364

  Fly   376 SISEVLR-YSSSPIVPHVAMEDTV-IKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPERFLEN 438
            .:.|..| :.::|.:.....|..| |.||.|.|.:.|.:|.:.:......|.:|..|:|||||  
plant   365 VVKETFRLHPAAPFLLQRKAETNVEILGFTVLKDSQVLVNVWAIGRDPLVWENPTHFEPERFL-- 427

  Fly   439 NFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSVGKRTCIGQ 503
                .||..:|..|.:.|                                   ||..|:|.|.|.
plant   428 ----GKEIDVKGTDYELT-----------------------------------PFGAGRRICPGL 453

  Fly   504 SLVRGFGFLLLANIIQNY------NVNSADFSK-----IKLEKSS--IALPKK 543
            .|......|:||:::..:      .|.|.|...     :.:.|::  :|:|.|
plant   454 PLAMKTVHLMLASLLYTFEWKLPNGVGSEDLDMEETFGLTVHKTNPLLAVPLK 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 122/532 (23%)
CYP76C6NP_174633.1 p450 11..504 CDD:299894 126/561 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.