DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and CYP703A2

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_171635.1 Gene:CYP703A2 / 839470 AraportID:AT1G01280 Length:510 Species:Arabidopsis thaliana


Alignment Length:572 Identity:139/572 - (24%)
Similarity:226/572 - (39%) Gaps:114/572 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFAIAITIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPIIGNINLLGRFQYNP 73
            |||:.|..:|:........||.:..                 .|||...||:||:..||..   |
plant     8 LFAVLILNVLLWRWLKASACKAQRL-----------------PPGPPRLPILGNLLQLGPL---P 52

  Fly    74 FYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRP-DFFRYHKLFG-GDRNN 136
            .....:|..|||.:..|.||:...|..|:.|.|:|:|.:....|..|| .....|..:| ||   
plant    53 HRDLASLCDKYGPLVYLRLGNVDAITTNDPDTIREILLRQDDVFSSRPKTLAAVHLAYGCGD--- 114

  Fly   137 SLALCDWSQLQQKRRNLARRH-CSPRESSSYFSKMSEIGGLEVNQLL-DQLTNISSGYPCDVKPL 199
             :||.......::.|.:...| .:.:...|:.::.:|    |...|: |......:|.|.::|.:
plant   115 -VALAPMGPHWKRMRRICMEHLLTTKRLESFTTQRAE----EARYLIRDVFKRSETGKPINLKEV 174

  Fly   200 ILAASANMFCQYMCSVRF-----NYSDKGFQKIIEYFDEIFWEINQGYSFDYIP---WLVPFYCN 256
            :.|.|.|...:.:...:|     ..|.|..|:.:....::||.:...|..||:|   |:.|..|.
plant   175 LGAFSMNNVTRMLLGKQFFGPGSLVSPKEAQEFLHITHKLFWLLGVIYLGDYLPFWRWVDPSGCE 239

  Fly   257 HISRIVHWSASIRKFILERIVNHRESNININEP--DKDFTDALL-------KSLKEDKNVSRNTI 312
            ...|.|  ...:.:|..:.|..||.:.:...:.  |.||.|.||       |:..||..:..   
plant   240 KEMRDV--EKRVDEFHTKIIDEHRRAKLEDEDKNGDMDFVDVLLSLPGENGKAHMEDVEIKA--- 299

  Fly   313 IFMLEDFIGG---HSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDMNVMPYTM 374
              :::|.|..   .|||.|  ..|:|...|.|.:...|:.|:|.|.... |.:...|:..:.|..
plant   300 --LIQDMIAAATDTSAVTN--EWAMAEAIKQPRVMRKIQEELDNVVGSN-RMVDESDLVHLNYLR 359

  Fly   375 ASISEVLR-YSSSP-IVPHVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPERFLE 437
            ..:.|..| :.:.| ::||.::..|.|.|:.:...|.||||.:.|..:...|:..|.|.|||.. 
plant   360 CVVRETFRMHPAGPFLIPHESVRATTINGYYIPAKTRVFINTHGLGRNTKIWDDVEDFRPERHW- 423

  Fly   438 NNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQF--LPFSVGKRTC 500
                                     ..:||      |:..:::.      |.|  ||||.|||.|
plant   424 -------------------------PVEGS------GRVEISHG------PDFKILPFSAGKRKC 451

  Fly   501 IGQSLVRGFGFLLLANIIQNY------NVNSADFSKIKLEKS----SIALPK 542
            .|..|......:.||.:...:      |:::.:...:.:.|:    :||.|:
plant   452 PGAPLGVTMVLMALARLFHCFEWSSPGNIDTVEVYGMTMPKAKPLRAIAKPR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 132/529 (25%)
CYP703A2NP_171635.1 PLN03112 1..510 CDD:215583 139/572 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.