DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and CYP71B7

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_172770.1 Gene:CYP71B7 / 837868 AraportID:AT1G13110 Length:504 Species:Arabidopsis thaliana


Alignment Length:554 Identity:115/554 - (20%)
Similarity:221/554 - (39%) Gaps:95/554 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VFLLLKCKQKAFVV-IGLLYQEKKYQCFDQAPGPHPWPIIGNI-NLLGRFQYNPFYGFGTLTKKY 84
            :.|...|....|:| :.:|.:..|...:...|||...|||||: ||.|.    |...|..|::|:
plant     3 ILLCFLCLLPVFLVSLSILSKRLKPSKWKLPPGPKTLPIIGNLHNLTGL----PHTCFRNLSQKF 63

  Fly    85 GDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYHKLFGGDRNNSLALC--DWSQLQ 147
            |.:..|..|....:|:::.:..:|.|.........||:......:....::...|..  :|..| 
plant    64 GPVMLLHFGFVPVVVISSKEGAEEALKTQDLECCSRPETVATRMISYNFKDIGFAPYGEEWKAL- 127

  Fly   148 QKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNISSGYPCDVKPLILAASANMFCQYM 212
              |:.:.....:.::..|:.....|...|.:.:|.:.....|   |.::|..:....|::.|:..
plant   128 --RKLVVMELLNTKKFQSFRYIREEENDLLIKKLTESALKKS---PVNLKKTLFTLVASIVCRLA 187

  Fly   213 CSVRFNYSDKGFQKIIEYFDE--------IFWEINQGYSF-DYIP---WLVPFYCNHISRIVHWS 265
            ..|..:.        .|:.||        .|..:..|.:| |:.|   |||.........:.:..
plant   188 FGVNIHK--------CEFVDEDNVADLVNKFEMLVAGVAFTDFFPGVGWLVDRISGQNKTLNNVF 244

  Fly   266 ASIRKFILERIVNHRESNININEPDKDFTDALLKSLK------EDKNVSRNTIIFMLED-FIGGH 323
            :.:..|....:.:|.:....::| :.|..|.:|..:|      |...::.:.:..::.| |:.|.
plant   245 SELDTFFQNVLDDHIKPGRQVSE-NPDVVDVMLDLMKKQEKDGESFKLTTDHLKGIISDIFLAGV 308

  Fly   324 SAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDMNVMPYTMASISEVLR-YSSSP 387
            :.....:..|:|.:.:||.:...:::|:.|......:||...|::.:.|....:.|:.| :.::|
plant   309 NTSAVTLNWAMAELIRNPRVMKKVQDEIRTTLGDKKQRITEQDLSQVHYFKLVVKEIFRLHPAAP 373

  Fly   388 -IVPHVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPERFLENNFTNNKESGLKCD 451
             ::|...|....|:|:.:...|.:.||.|.:......|.:|::|:|:|||:::.           
plant   374 LLLPRETMSHVKIQGYDIPVKTQMMINIYSIARDPKLWTNPDEFNPDRFLDSSI----------- 427

  Fly   452 DNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSVGKRTCIGQSLVRGFGFLLLAN 516
            |.:...|                              :.|||..|:|.|.|.:|......|.|.|
plant   428 DYRGLNF------------------------------ELLPFGSGRRICPGMTLGITTVELGLLN 462

  Fly   517 IIQNYN------VNSADFSKIKLEKS-SIALPKK 543
            ::..::      .|..|   |.||:: ||.:.||
plant   463 LLYFFDWVVPVGKNVKD---INLEETGSIIISKK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 109/523 (21%)
CYP71B7NP_172770.1 CYP71-like 62..496 CDD:410695 95/491 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.