DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and CYP71A20

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_193067.3 Gene:CYP71A20 / 826961 AraportID:AT4G13310 Length:497 Species:Arabidopsis thaliana


Alignment Length:531 Identity:114/531 - (21%)
Similarity:227/531 - (42%) Gaps:92/531 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IAITIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPIIGNINLLGRFQYNPFYG 76
            |.||:.|.:.:.||||.          :.:....:.|:..|.|...|:|||::.|....:.   .
plant     4 ILITLCLTTLLALLLKS----------ILKRTATKNFNLPPSPWRLPVIGNLHQLSLHTHR---S 55

  Fly    77 FGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYHKLFGGDRNNSLALC 141
            ..:|:.:||.:..|..|.|..::|::.|:..:|:..:......||......|:..|.|:  :|..
plant    56 LRSLSLRYGPLMLLHFGRTPVLIVSSADVAHDVMKTHDLVCANRPKTKVVDKILSGGRD--VAFA 118

  Fly   142 DWSQLQQKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNI---SSGYPCDVKPLILAA 203
            .:.:..::.:::..::....:....:.|:.|   .|:.:::::|...   ||..|.::..:::..
plant   119 PYGEYWRQMKSICIQNLLNNKMVRSYEKIRE---EEIKRMIEKLEKASCSSSPSPVNLSQILMTL 180

  Fly   204 SANMFCQYMCSVRFNYSDKGF--QKIIEYFDEIFWEINQGYSFDYIP---WLVPFYCNHISRIVH 263
            :.::.|:.....:::....|.  :.|:..|..:..|...|   :|||   |:     :.|..:.|
plant   181 TNDIICRVALGRKYSGKKDGIDVENIVRTFAALLGEFPVG---EYIPSLSWI-----DRIRGLDH 237

  Fly   264 WSASI-RKF--ILERIV-NHRESNININEPDKDFTDALLKSLKEDK----NVSRNTIIFMLED-F 319
            ....: ::|  .|||:| .|.|::   .|...|..|.|| :::.||    .:.::.:..::.| |
plant   238 KMEVVDKRFDEFLERVVKEHEEAD---KETRSDLVDKLL-TIQSDKTGQFELEKSALKLIIWDMF 298

  Fly   320 IGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDMNVMPYTMASISEVLRY- 383
            :.|.:...:.:..|:..:.:||.:...::.|:.:.|.:.: .:...:...|.|..|.|.|.||. 
plant   299 LAGTATTLSFLEWAMTELMRNPKVMKKLQEEIRSSSPQDL-FVTEKEAEKMNYLQAVIKEALRLR 362

  Fly   384 SSSP-IVPHVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFW-NHPEQFDPERFLENNFTNNKES 446
            ..:| :||.|..||..:||:.:..||.|.:|.:.:....:.| ...|:|.|||.|:.|.      
plant   363 PPAPLLVPRVLSEDVKLKGYNIPAGTQVIVNAWAIQRDTTTWGTDAEEFKPERHLDTNL------ 421

  Fly   447 GLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSVGKRTCIGQSLVRGFGF 511
                 |.:..:|                              :|:||..|||.|.|.........
plant   422 -----DFQGQDF------------------------------KFIPFGSGKRICPGIGFTSALIG 451

  Fly   512 LLLANIIQNYN 522
            :.||||::.:|
plant   452 VTLANIVKRFN 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 105/491 (21%)
CYP71A20NP_193067.3 p450 24..494 CDD:299894 106/501 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.