DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and CYP71B38

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_190011.1 Gene:CYP71B38 / 823550 AraportID:AT3G44250 Length:499 Species:Arabidopsis thaliana


Alignment Length:524 Identity:114/524 - (21%)
Similarity:213/524 - (40%) Gaps:98/524 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PGPHPWPIIGNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKY 116
            |||...|||||::.||:..|..|:   .::::||.:..|.||....|||::.:..:|||..:...
plant    30 PGPIGLPIIGNLHQLGKLLYKSFH---KISQEYGPVVLLRLGVVPVIVVSSKEGAEEVLKTHDLE 91

  Fly   117 FGGRP-----DFFRYH-KLFG----GDRNNSLALCDWSQLQQKRRNLARRHCSPRESSSYF-SKM 170
            ...||     ..|.|: |..|    ||        ||.:: :|...|........:|..|. .:.
plant    92 TCTRPKTAATGLFTYNFKDIGFAPFGD--------DWREM-RKITTLELFSVKKLKSFRYIREEE 147

  Fly   171 SEIGGLEVNQLLDQLTNISSGYPCDVKPLILAASANMFCQYMCSVRF---NYSDKGFQKIIEYFD 232
            ||:...::::.:|:..|.|    .|::.::.:.:|::.|:......|   ::.|...::::    
plant   148 SELLVKKISKSVDETQNSS----VDLRKVLFSFTASIICRLAFGQNFHQCDFVDASLEELV---- 204

  Fly   233 EIFWEINQG-YSF-DYIP--WLVPFYCNHISRIVHWSASIRKFILERIVNHRESNININEPD--K 291
             :..|.|.| ::| |:.|  ||:.......||:......:..|....|.:|    :...:|.  .
plant   205 -LESEANLGTFAFADFFPGGWLIDRISGQHSRVNKAFYKLTNFYKHVIDDH----LKTGQPQDHS 264

  Fly   292 DFTDALLKSLKEDKNVSRNTIIF------MLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNE 350
            |....:|..:.:........:.:      |.:.|:.|.:...|.::..|..::::|.:...::.|
plant   265 DIVSVMLDMINKPTKADSFKVTYDHLKGVMSDIFLAGVNGGANTMIWTLTELSRHPRVMKKLQEE 329

  Fly   351 VDTVSAKGIRRICLYDMNVMPYTMASISEVLR-YSSSP-IVPHVAMEDTVIKGFGVRKGTIVFIN 413
            :..:......||...|:..:.|....:.|..| :..:| ::|.:.|.|..|:|:.:.|.|::.||
plant   330 IRAMLGPNKERITEEDLEKVEYLKLVMVETFRLHPPAPLLLPRLTMSDIKIQGYNIPKNTMIQIN 394

  Fly   414 NYVLNMSESFWNHPEQFDPERFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNL 478
            .|.:.....:|..|.:|.|||||::..           |.|...|                    
plant   395 TYAIGRDPKYWKQPGEFIPERFLDSPI-----------DYKGQHF-------------------- 428

  Fly   479 NNKLLKKSIPQFLPFSVGKRTCIGQSLVRGFGFLLLANIIQNYN---VNSADFSKIKLEK-SSIA 539
                      :.|||..|:|.|.|.:.......|.|.|::..::   .|......|.:|: ...|
plant   429 ----------ELLPFGAGRRICPGMATGITMVELGLLNLLYFFDWSLPNGMTIEDIDMEEDEGFA 483

  Fly   540 LPKK 543
            :.||
plant   484 IAKK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 114/524 (22%)
CYP71B38NP_190011.1 p450 27..497 CDD:386267 114/524 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.