DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and CYP71B36

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_189263.1 Gene:CYP71B36 / 822236 AraportID:AT3G26320 Length:500 Species:Arabidopsis thaliana


Alignment Length:542 Identity:126/542 - (23%)
Similarity:225/542 - (41%) Gaps:116/542 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPIIGNINLLGRFQYNPFYGFGT 79
            ||:.:|.:|  |.|     :::.....:|:.|...:.|.|..:|||||::.||..   |......
plant     3 TILFLSLLF--LSC-----ILLAAFTHKKRQQHQRKPPSPPGFPIIGNLHQLGEL---PHQSLWR 57

  Fly    80 LTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYHKLFGGDRNNSLALCD-- 142
            |:||||.:..|..|....:||::.:..|:||..:..:...||.       ..|.|..|....|  
plant    58 LSKKYGHVMLLKFGSIPTVVVSSSETAKQVLKIHDLHCCSRPS-------LAGPRALSYNYLDIA 115

  Fly   143 -------WSQLQQKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLT-NISSGYPCDVKPL 199
                   |.:|   ||...:...|.:...| |..:.|.   ||.:|:|.:: :.|.|.|.::...
plant   116 FSPFDDYWKEL---RRICVQELFSVKRVQS-FQPIKED---EVKKLIDSVSESASQGTPVNLSEK 173

  Fly   200 ILAASANMFCQYMCSVRFN----YSDKGFQKIIEYFDEIFWEINQGYSFDYIP---WLVPFYCN- 256
            ..:.:..:.|:....|.|.    .||: |:|:|.   :.:..:....:.||.|   |::.:... 
plant   174 FTSLTVRVTCKATFGVNFQGTVLNSDR-FEKLIH---DTYLFLGSFSASDYFPNGGWIIDWLTGL 234

  Fly   257 HISRIVHWSASIR---KFILERIVNHRESNININEPDKDFTDALLKSLKEDK-----NVSRNTI- 312
            |..|    ..|:|   .|..:....|::.|   .|..:||.|.||:..||:.     .::||.| 
plant   235 HGQR----ERSVRALDAFYEQMFDLHKQGN---KEGVEDFVDLLLRLEKEETVIGYGKLTRNHIK 292

  Fly   313 IFMLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEV-DTVSAKGIRRICLYDMNVMPYTMAS 376
            ..::...|||.......:..|:..:.:||.:...:::|: :.:..|.:  |.|.|::.:.|....
plant   293 AILMNVLIGGIGTSAITMTWAMTELMRNPRVMKKVQSEIRNQIGKKSM--ITLDDIDQLHYLKMV 355

  Fly   377 ISEVLR-YSSSP-IVPHVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPERFLENN 439
            |:|..| :..|| ::|...|.:..:..:.:...|.:::|.:.:......|..||:|.||||:.::
plant   356 INETWRLHPPSPFLIPRQVMSEFELNDYVIPVKTRLYVNVWAIGRDPDTWKDPEEFLPERFVNSS 420

  Fly   440 FTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSVGKRTC---- 500
            .           |.|...|                              :.|||..|:|.|    
plant   421 I-----------DAKGQHF------------------------------ELLPFGSGRRMCPAMY 444

  Fly   501 IGQSLVRGFGFLLLANIIQNYN 522
            :|.::|. ||   |||::.:::
plant   445 MGTTMVE-FG---LANMLYHFD 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 118/505 (23%)
CYP71B36NP_189263.1 p450 20..498 CDD:299894 120/518 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.