DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and CYP82G1

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_189154.1 Gene:CYP82G1 / 822110 AraportID:AT3G25180 Length:515 Species:Arabidopsis thaliana


Alignment Length:568 Identity:135/568 - (23%)
Similarity:226/568 - (39%) Gaps:118/568 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFAIAITIILISYVFL---LLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHP---WPIIGNINLLG 67
            ||::|  :::..|:||   |.:|:                  .|.:..|.|   .|:.|:::|| 
plant    12 LFSLA--LVIFGYIFLRKQLSRCE------------------VDSSTIPEPLGALPLFGHLHLL- 55

  Fly    68 RFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPD--FFRYHKLF 130
            |.:.........:::|:|.|:||.||..|.:|.::...:|:....|......||:  |.||    
plant    56 RGKKLLCKKLAAMSQKHGPIFSLKLGFYRLVVASDPKTVKDCFTTNDLATATRPNIAFGRY---- 116

  Fly   131 GGDRNNSLALCDWSQLQQKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNISSGYP-C 194
            .|..|.||.|..:....::.|.:...|.....|   ...:..|...|||.|:..|...:.|.. .
plant   117 VGYNNASLTLAPYGDYWRELRKIVTVHLFSNHS---IEMLGHIRSSEVNTLIKHLYKGNGGTSIV 178

  Fly   195 DVKPLILAASANMFCQYMCSVRFNYSDKGFQKIIEYFDEIFWEINQGYSF-----------DYIP 248
            .:..|....:.|:..:.|...|.     ||.::..  ||  |...:....           |.||
plant   179 KIDMLFEFLTFNIILRKMVGKRI-----GFGEVNS--DE--WRYKEALKHCEYLAVIPMIGDVIP 234

  Fly   249 WL--VPFYCN-HISRIVHWSASIR-KFILERIVNHRESNININEPDKDFT--DALLKSLKEDKNV 307
            ||  :.|..| .:.|:.....|:. |::.|.:.....     ||.|::.|  |.||..|.||..:
plant   235 WLGWLDFAKNSQMKRLFKELDSVNTKWLHEHLKKRSR-----NEKDQERTIMDLLLDILPEDIVI 294

  Fly   308 S---RNTII--FMLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDM 367
            |   |:.|:  .:|...:.|..:....:..|::.:..||......:.|:|....|| |.|...|:
plant   295 SGHVRDVIVKATILALTLTGSDSTSITLTWAVSLLLNNPAALEAAQEEIDNSVGKG-RWIEESDI 358

  Fly   368 NVMPYTMASISEVLR-YSSSPIVP-HVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQF 430
            ..:.|..|.:.|..| |..:|:.. ..|.||..:.|:.|.|||.:.:|.:.|:.....|..|:.|
plant   359 QNLKYLQAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEKGTRLLVNIWKLHRDPKIWPDPKTF 423

  Fly   431 DPERFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSV 495
            .||||:|:                              ||:           .:||..:::||..
plant   424 KPERFMED------------------------------KSQ-----------CEKSNFEYIPFGS 447

  Fly   496 GKRTCIGQSLVRGFGFLLLANIIQNYNVNSADFSKIKL-EKSSIALPK 542
            |:|:|.|.:|.......:||.::|.:.::......:.: |...:||||
plant   448 GRRSCPGVNLGLRVVHFVLARLLQGFELHKVSDEPLDMAEGPGLALPK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 126/522 (24%)
CYP82G1NP_189154.1 p450 8..514 CDD:299894 135/568 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.