DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and Cyp2s1

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001100965.1 Gene:Cyp2s1 / 308445 RGDID:1306078 Length:499 Species:Rattus norvegicus


Alignment Length:531 Identity:137/531 - (25%)
Similarity:228/531 - (42%) Gaps:101/531 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PGPHPWPIIGNINLLGRFQYNP---FYGFGTLTKKYGDIYSLSLG-HTRCIVVNNVDLIKEVLNK 112
            |||.|.|::||:     .|..|   :.||..|:||||.::::.|| ..|.:|:...|.|:|.|..
  Rat    33 PGPTPLPLLGNL-----LQLRPGALYSGFLRLSKKYGPVFTVHLGPWRRVVVLVGHDAIREALGG 92

  Fly   113 NGKYFGGRPDFFRYHKLF--------GGDRNNSLALCDWSQLQQKRRNLARRH--CSPRESSSYF 167
            ..:.|.||.......|.|        .|:|        |.|| :|...||.|.  ...||.....
  Rat    93 QAEEFSGRGTLATLDKTFDGHGVFFANGER--------WKQL-RKFTLLALRDLGMGKREGEELI 148

  Fly   168 SKMSEIGGLEVNQLLDQLTNISSGYPCDVKPLILAASANMFCQYMCSVRFNYSDKGFQKIIEYFD 232
            .:       ||..|:..... :.|.|.:...|:..|::|:.|..:..:|..|.||.||.:|:...
  Rat   149 QE-------EVQNLVKAFQR-TEGRPFNPSMLLAQATSNVVCSLIFGIRLPYEDKEFQAVIQAAS 205

  Fly   233 EIFWEINQ--GYSFDYIPWLV-PFYCNHISRIVHWSASIRKFILERIVNHRESNININEPDKDFT 294
            .....|:.  |.:::...||: |....| :::.|...::..|.::::..| :...:.:.|.:|..
  Rat   206 GTLLGISSPWGQAYEMFSWLLQPLPGPH-TQLQHHLGTLAAFTIQQVQRH-QGRSHTSGPARDVV 268

  Fly   295 DALLKSLKEDKN------VSRNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDT 353
            ||.|:.:.::|.      ..:|.::.:......|...:|..:..||..:.|.|.:...:|.|:  
  Rat   269 DAFLQKMAQEKEDPGTEFTEKNLLMTVTYLLFAGTMTIGATIRYALLLLLKYPQVQKRVREEL-- 331

  Fly   354 VSAKGIRRI-CLYDMNVMPYTMASISEVLR-YSSSPI-VPHVAMEDTVIKGFGVRKGTIVF-INN 414
            :...|..|. .|.|...:|||.|.:.|..| .:..|: :||...:.|..:|:.:.|||.|| :..
  Rat   332 IQELGPSRTPSLSDRVRLPYTDAVLHEAQRLLALVPMGMPHTVTKTTSFRGYTLPKGTEVFPLIG 396

  Fly   415 YVLNMSESFWNHPEQFDPERFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLN 479
            .||:....|.| ||:|.|.|||              ||:.|   |||::                
  Rat   397 SVLHDPAVFRN-PEEFHPSRFL--------------DDDGR---IRKHE---------------- 427

  Fly   480 NKLLKKSIPQFLPFSVGKRTCIGQSLVRGFGFLLLANIIQNYNVNS----ADFSKIKLEKSSIAL 540
                     .|||:|:|||.|:|:.|.|...:|...:|:|.:::::    .|.|.....:....:
  Rat   428 ---------AFLPYSLGKRVCLGEGLARAELWLFFTSILQAFSLDTPCPPGDLSLKPAVRGLFNI 483

  Fly   541 PKKCFKLSLRP 551
            |.. |:|.:.|
  Rat   484 PPD-FQLQVWP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 136/527 (26%)
Cyp2s1NP_001100965.1 p450 48..491 CDD:365848 128/507 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.