DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and Cyp2c7

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_058854.1 Gene:Cyp2c7 / 29298 RGDID:620379 Length:490 Species:Rattus norvegicus


Alignment Length:578 Identity:148/578 - (25%)
Similarity:237/578 - (41%) Gaps:143/578 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPIIGNI------NL---LGRFQYNP 73
            |::::.|.|    .:.:::.|..|..:.:  ...|||.|.|||||.      |:   |.:|    
  Rat     3 LVTFLVLTL----SSLILLSLWRQSSRRR--KLPPGPTPLPIIGNFLQIDVKNISQSLTKF---- 57

  Fly    74 FYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGR---PDFFRYHKLFG---- 131
                   :|.||.:::|.||....::::..:.|||.|..||:.|.||   |......|.||    
  Rat    58 -------SKTYGPVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGRGSYPMNENVTKGFGIVFS 115

  Fly   132 -GDRNNSLALCDWSQLQQ----KRRNL--ARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNIS 189
             |:|        |.::::    ..|||  .:|:...|...            |...|:::|.. :
  Rat   116 NGNR--------WKEMRRFTIMNFRNLGIGKRNIEDRVQE------------EAQCLVEELRK-T 159

  Fly   190 SGYPCDVKPLILAASANMFCQYMCSVRFNYSDKGFQKIIEYFDEIFWEINQGYSFDYIPWLVPFY 254
            .|.|||...::..|..|:.|.......|:|.||.....:|       ::|:.......||:.  .
  Rat   160 KGSPCDPSLILNCAPCNVICSITFQNHFDYKDKEMLTFME-------KVNENLKIMSSPWMQ--V 215

  Fly   255 CNHISRIVHWSAS-----------IRKFILERIVNHRESNININEPDKDFTDALLKSLKEDKNV- 307
            ||....::.:...           ::.::|::|..|:|| :::..| :||.|..|...|:..|: 
  Rat   216 CNSFPSLIDYFPGTHHKIAKNINYMKSYLLKKIEEHQES-LDVTNP-RDFVDYYLIKQKQANNIE 278

  Fly   308 ----SRNTIIFMLEDFIG-GHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDM 367
                |...:...:.|.|| |...:...:..||..:.|.|.:...::.|:|.|..:. |..|:.|.
  Rat   279 QSEYSHENLTCSIMDLIGAGTETMSTTLRYALLLLMKYPHVTAKVQEEIDRVIGRH-RSPCMQDR 342

  Fly   368 NVMPYTMASISEVLRYSS--SPIVPHVAMEDTVIKGFGVRKGTIVFIN-NYVLNMSESFWNHPEQ 429
            ..||||.|.|.||.|:.:  ...:||....|...:.:.:.|||.|..: ..||:.|:.|.| ||.
  Rat   343 KHMPYTDAMIHEVQRFINFVPTNLPHAVTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPN-PEM 406

  Fly   430 FDPERFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFS 494
            |||..||:.|                          |:.|...|                |||||
  Rat   407 FDPGHFLDEN--------------------------GNFKKSDY----------------FLPFS 429

  Fly   495 VGKRTCIGQSLVRGFGFLLLANIIQNYNVNS----ADFSKIKLEKSSIALP---KKCF 545
            .|||.|:|:.|.|...||.|..|:||:|:.|    .|...:.:.....:||   :.||
  Rat   430 AGKRACVGEGLARMQLFLFLTTILQNFNLKSLVHPKDIDTMPVLNGFASLPPTYQLCF 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 143/544 (26%)
Cyp2c7NP_058854.1 p450 30..487 CDD:278495 141/543 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.