DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and Cyp2c11

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_062057.2 Gene:Cyp2c11 / 29277 RGDID:2469 Length:500 Species:Rattus norvegicus


Alignment Length:503 Identity:126/503 - (25%)
Similarity:213/503 - (42%) Gaps:102/503 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PGPHPWPIIGNINLLGRFQYNPFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKY 116
            |||.|.||||  |.|..:..:........:|.||.|::|.||....:|::..:.:||.|...|:.
  Rat    31 PGPTPLPIIG--NTLQIYMKDIGQSIKKFSKVYGPIFTLYLGMKPFVVLHGYEAVKEALVDLGEE 93

  Fly   117 FGGRPDF---FRYHKLFGGDRNNSLALCDWSQLQQ------KRRNLARRHCSPRESSSYFSKMSE 172
            |.||..|   .|.:|..|...:|.:   .|.::::      :...:.:|....|...        
  Rat    94 FSGRGSFPVSERVNKGLGVIFSNGM---QWKEIRRFSIMTLRTFGMGKRTIEDRIQE-------- 147

  Fly   173 IGGLEVNQLLDQLTNISSGYPCDVKPLILAASANMFCQYMCSVRFNYSDKGFQKIIEYFDEIFWE 237
                |...|:::|.. |.|.|.|...::..|..|:.|..:...||:|.|..|..::..|:|.|..
  Rat   148 ----EAQCLVEELRK-SKGAPFDPTFILGCAPCNVICSIIFQNRFDYKDPTFLNLMHRFNENFRL 207

  Fly   238 INQGYSFDYIPWLVPFYCNHISRIVHWSAS-----------IRKFILERIVNHRESNININEPDK 291
            .:.       |||.  .||....|:.:...           |:.::||::..|:|| ::.:.| :
  Rat   208 FSS-------PWLQ--VCNTFPAIIDYFPGSHNQVLKNFFYIKNYVLEKVKEHQES-LDKDNP-R 261

  Fly   292 DFTDALLKSLKEDKN-----VSRNTIIFMLEDFIG-GHSAVGNLVMLALAYIAKNPTIALHIRNE 350
            ||.|..|..::::|:     .:..:::..:.|..| |.......:...|..:.|:..:...::.|
  Rat   262 DFIDCFLNKMEQEKHNPQSEFTLESLVATVTDMFGAGTETTSTTLRYGLLLLLKHVDVTAKVQEE 326

  Fly   351 VDTVSAKGIRRICLYDMNVMPYTMASISEVLRYSS--SPIVPHVAMEDTVIKGFGVRKGTIVFIN 413
            ::.|..:. |..|:.|.:.||||.|.:.|:.||..  ...:||:...|...:.:.:.|||.|.::
  Rat   327 IERVIGRN-RSPCMKDRSQMPYTDAVVHEIQRYIDLVPTNLPHLVTRDIKFRNYFIPKGTNVIVS 390

  Fly   414 -NYVLNMSESFWNHPEQFDPERFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQN 477
             :.:|:..:.|.| ||:|||..||                          |..|:.|...|    
  Rat   391 LSSILHDDKEFPN-PEKFDPGHFL--------------------------DERGNFKKSDY---- 424

  Fly   478 LNNKLLKKSIPQFLPFSVGKRTCIGQSLVRGFGFLLLANIIQNYNVNS 525
                        |:|||.|||.|.|::|.|...||....|:||:|:.|
  Rat   425 ------------FMPFSAGKRICAGEALARTELFLFFTTILQNFNLKS 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 126/503 (25%)
Cyp2c11NP_062057.2 p450 30..487 CDD:278495 126/503 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.