DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and Cyp2r1

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_796356.2 Gene:Cyp2r1 / 244209 MGIID:2449771 Length:501 Species:Mus musculus


Alignment Length:543 Identity:142/543 - (26%)
Similarity:231/543 - (42%) Gaps:112/543 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AIAITIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPIIGNINLLGRFQYNPFY 75
            |:|..::|:.:|           :|:..|.::::...|  .|||...|.:|||..|......|..
Mouse    13 ALAGALLLLLFV-----------LVVRQLLRQRRPAGF--PPGPPRLPFVGNICSLALSADLPHV 64

  Fly    76 GFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYHKL--FGGDRNNSL 138
            .....::.||:|:||.||....:|:|..|::||.|....:.|..||....:.|:  .||..|:..
Mouse    65 YMRKQSRVYGEIFSLDLGGISTVVLNGYDVVKECLVHQSEIFADRPCLPLFMKMTKMGGLLNSRY 129

  Fly   139 ALCDWSQLQQKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNISSGYPCDVKPLILAA 203
            .. .|  :..:|..:...|.......|:.||:.|    |...|:|.:.....| |.|:|.||..|
Mouse   130 GR-GW--IDHRRLAVNSFHYFGSGQKSFESKILE----ETWSLIDAIETYKGG-PFDLKQLITNA 186

  Fly   204 SANMFCQYMCSVRFNYSDKGFQKIIEYFDEIFWEINQG---YSFDYIPW--LVPF---------- 253
            .:|:....:...||.|.|..||.:||.|.|.. |:...   :.::..||  ::||          
Mouse   187 VSNITNLILFGERFTYEDTDFQHMIELFSENV-ELAASAPVFLYNAFPWIGILPFGKHQRLFRNA 250

  Fly   254 --YCNHISRIVHWSASIRKFILERIVNHRESNININEPDKDFTDALLKSLKEDKN-----VSRNT 311
              ..:.:||::..:|..||   ..:.:|             |.||.|..:.:.:|     .|:..
Mouse   251 DVVYDFLSRLIEKAAVNRK---PHLPHH-------------FVDAYLDEMDQGQNDPLSTFSKEN 299

  Fly   312 IIFML-EDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDMNVMPYTMA 375
            :||.: |..|.|.....|::..|:.::|..|.|...:..|:|.:.....|....|... ||||.|
Mouse   300 LIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVHKEIDLIVGHNRRPSWEYKCK-MPYTEA 363

  Fly   376 SISEVLRYSSSPIVP----HVAMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPERFL 436
            .:.||||:.:  |||    |...||.|::|:.:.|||.|..|.|.::..|.:|..|:.|.|||||
Mouse   364 VLHEVLRFCN--IVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWKDPDMFYPERFL 426

  Fly   437 ENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSVGKRTCI 501
            ::|....|:..|                                          :|||:|:|.|:
Mouse   427 DSNGYFTKKEAL------------------------------------------IPFSLGRRHCL 449

  Fly   502 GQSLVRGFGFLLLANIIQNYNVN 524
            |:.|.|...||...:::|.::::
Mouse   450 GEQLARMEMFLFFTSLLQQFHLH 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 135/502 (27%)
Cyp2r1NP_796356.2 p450 40..497 CDD:278495 135/503 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.