DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and Cyp2ab1

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_017172441.1 Gene:Cyp2ab1 / 224044 MGIID:3644957 Length:459 Species:Mus musculus


Alignment Length:478 Identity:120/478 - (25%)
Similarity:190/478 - (39%) Gaps:115/478 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRP--DFFRYHKLFGGDR---NNSLA 139
            |.:.:|.::::.||.|..:|::....:||.|..|.:.|.|||  .|||  .|||...   :|.|.
Mouse    19 LAQTHGSVFTVWLGSTPIVVLSGFRAVKEALVSNSEQFSGRPLTPFFR--DLFGEKGVICSNGLT 81

  Fly   140 LCDWSQLQQKRRNLARRHCSPRESSSYFSKMSEIG----GLEVNQLLDQLTNIS------SGYPC 194
               |.|        .||.|        .:.:.|:|    .||| ||..:...::      .|...
Mouse    82 ---WRQ--------QRRFC--------LTTLRELGLGKQALEV-QLQHEAAELAKVFLQEEGRAF 126

  Fly   195 DVKPLILAASANMFCQYMCSVRFNYSDKGFQKIIEYFDEIFWEINQGYSF---------DYIPWL 250
            |.:..|:.::..:....:....|...:..|.::|:       .||.|.:|         |..||.
Mouse   127 DPQIPIIRSTTRVIGTLVFGHHFLSEEPIFLELIQ-------AINLGLAFASTIWRRLYDMFPWA 184

  Fly   251 VPFYCNHIS----RIVHWSASIRKFILERIVNHRESNININEPDKDFTDALLKSLKE--DKNVS- 308
            :    .|:|    :|..:..::|.||...|:.|:   :...|..|||.:..|..:.:  |..|| 
Mouse   185 L----RHLSGPHQKIFQYHEAVRGFIRHEIIRHK---LRTAEAPKDFINCYLSQITKAIDDPVST 242

  Fly   309 ---RNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDMNVM 370
               .|.|..:::.|:||.......:..||.|:..:..|...::.|:|.:.. ..:.||..|...:
Mouse   243 FSEENLIQVVIDLFLGGTDTTATTLHWALIYLVHHRAIQERVQQELDEMLG-AAQTICYEDRERL 306

  Fly   371 PYTMASISEVLRYSSSPIVPHV--AMEDTVIKGFGVRKGTIVFINNYVLNMSESFWNHPEQFDPE 433
            |||.|.:.||.|.||...|..|  .:..|.:.|:.|.||||:..|...:......|..|.||:|.
Mouse   307 PYTRAVLHEVQRLSSVVAVGAVRQCVTSTWMHGYYVPKGTIILPNLASVLYDPECWESPHQFNPG 371

  Fly   434 RFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSVGKR 498
            .||                          |.||:..:.:                .|||||.|.|
Mouse   372 HFL--------------------------DKDGNFVANE----------------AFLPFSAGHR 394

  Fly   499 TCIGQSLVRGFGFLLLANIIQNY 521
            .|.|:.|.|...||:.|.:::.:
Mouse   395 VCPGEQLARMELFLMFATLLRTF 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 120/478 (25%)
Cyp2ab1XP_017172441.1 p450 18..446 CDD:365848 120/478 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.