DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spok and Cyp2g1

DIOPT Version :9

Sequence 1:NP_001104460.2 Gene:spok / 5740359 FlyBaseID:FBgn0086917 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_038837.1 Gene:Cyp2g1 / 13108 MGIID:109612 Length:494 Species:Mus musculus


Alignment Length:547 Identity:135/547 - (24%)
Similarity:228/547 - (41%) Gaps:106/547 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTSVFYVLFAIAITIILISYVFLLLKCKQKAFVVIGLLYQEKKYQCFDQAPGPHPWPIIGNINL 65
            ||...|.:..|:.::.:||                  |:..::..:.....|||.|.|.:||.  
Mouse     2 MLGGAFSIFMALCLSCLLI------------------LIAWKRTSKGGKLPPGPTPIPFLGNF-- 46

  Fly    66 LGRFQYN---PFYGFGTLTKKYGDIYSLSLGHTRCIVVNNVDLIKEVLNKNGKYFGGRPDFFRYH 127
               .|..   .|..|..|.||||.::::..|....:|:...:.:||.|......|.||.:.....
Mouse    47 ---LQVRTDATFQSFQKLQKKYGSVFTVYFGPRPVVVLCGHEAVKEALVDQADDFSGRGEMPTLE 108

  Fly   128 KLFGGDRNNSLALCD---WSQLQQKRRNLARRHCSPRESSSYFSKMSEIGGLEVNQLLDQLTNIS 189
            |.|.|   ..|||.:   |..|::....:.|.....:.|..  .::.|    |...||::|..: 
Mouse   109 KNFQG---YGLALSNGERWKILRRFSLTVLRNFGMGKRSIE--ERIQE----EAGYLLEELHKV- 163

  Fly   190 SGYPCDVKPLILAASANMFCQYMCSVRFNYSDKGFQKIIEYFDEIFWEINQGYSFDY-IPWLVPF 253
            .|.|.|....:....:|:.|..:...||:|.|:.||.::...:|.|.|:::.::..| :.|.|..
Mouse   164 KGAPIDPTLYLSRTVSNVICSVVFGKRFDYQDQRFQSLMRMINESFVEMSKPWAQLYDMYWKVMQ 228

  Fly   254 YC----NHISRIVHWSASIRKFILERI-VNHRESNININEPDKDFTDALLKSLKEDKNVS----- 308
            |.    |::..::.   .::.||..|: :|  |::.:.:.| :||.|..|..:.:||:..     
Mouse   229 YFPGRHNYLYNLIE---DLKDFIASRVKIN--EASFDPSNP-RDFIDCFLIKMHQDKSDPHTEFN 287

  Fly   309 -RNTIIFMLEDFIGGHSAVGNLVMLALAYIAKNPTIALHIRNEVDTVSAKGIRRICLYDMNV-MP 371
             :|.::..|..|..|...|.:.:......:.|.|.:...|..|::.|.  |..|....|... ||
Mouse   288 LKNLVLTTLNLFFAGTETVSSTLRYGFLLLLKYPEVEAKIHEEINQVI--GTHRTPRVDDRAKMP 350

  Fly   372 YTMASISEVLRYSS-SPI-VPHVAMEDTVIKGFGVRKGTIVF-INNYVLNMSESFWNHPEQFDPE 433
            ||.|.|.|:.|.:. .|: |||....||..:|:.:.|||.|: :...||. ...::.:|:.|.|:
Mouse   351 YTDAVIHEIQRLTDIVPLGVPHNVTRDTHFRGYLLPKGTDVYPLFGSVLK-DPKYFRYPDAFYPQ 414

  Fly   434 RFLENNFTNNKESGLKCDDNKRTEFIRKNDNDGSTKSKKYGKQNLNNKLLKKSIPQFLPFSVGKR 498
            .||              |:..|   .:|||                         .|:.||.|||
Mouse   415 HFL--------------DEQGR---FKKND-------------------------AFVVFSSGKR 437

  Fly   499 TCIGQSLVRGFGFLLLANIIQNYNVNS 525
            .|:|::|.|...||...:|:|.:::.|
Mouse   438 ICVGEALARMELFLYFTSILQRFSLRS 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spokNP_001104460.2 p450 52..549 CDD:299894 128/496 (26%)
Cyp2g1NP_038837.1 p450 34..491 CDD:278495 128/497 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.