DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and Adcy7

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:281 Identity:84/281 - (29%)
Similarity:141/281 - (50%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1071 QLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSD-------------------VTIYFSDI 1116
            :|.:|:::.|.||..:||:.::..:|:.:....:|..|                   |:|.::||
  Rat   223 KLRVEKRQQENLLLSVLPAHISMGMKLAIIERLKEGGDRHYTPDNNFHSLYVKRHQNVSILYADI 287

  Fly  1117 VGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATM 1181
            ||||.:|:.|||.::|.:||:|:..||....|....:::.:||.|..||||||.:|.||.....|
  Rat   288 VGFTRLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKM 352

  Fly  1182 ALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWR 1246
            .||:.....:  |:...||.:.:|:|:|:|....||:||...:|.::...|:.|:|||:.|...|
  Rat   353 GLDICEAIKQ--VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGR 415

  Fly  1247 IHMSQETRDRLDARGGYAIEPRGLIDIKGKG--------MMN--TFWLLGKKGFDKPLPAPPPIG 1301
            :|:::.|.:.||.  .|.:|       .|.|        .||  |:.::..:....|||      
  Rat   416 VHITEATLNHLDK--AYEVE-------DGHGEQRDPYLKEMNIRTYLVIDPRSQQPPLP------ 465

  Fly  1302 ESHGLDESLIRNSITLKAQAN 1322
             ||.|.:.  :...|||.:|:
  Rat   466 -SHHLSKP--KGDATLKMRAS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 67/210 (32%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454 8/27 (30%)
Guanylate_cyc 272..422 CDD:306677 54/151 (36%)
DUF1053 487..593 CDD:399378
Guanylate_cyc 891..1087 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.