DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and Gucy1a2

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_076446.1 Gene:Gucy1a2 / 66012 RGDID:621655 Length:730 Species:Rattus norvegicus


Alignment Length:247 Identity:105/247 - (42%)
Similarity:141/247 - (57%) Gaps:6/247 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1054 LEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVG 1118
            |:|..:.|:..:.:..:.|:.|:|||..||..:.|..||::|.....|...:|.|||:.||||||
  Rat   463 LKKRMDKLKATLEKTHQALEEEKKKTVDLLYSIFPGDVAQQLWQRQQVQARKFDDVTMLFSDIVG 527

  Fly  1119 FTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMAL 1183
            ||.|.|.|:|:||:.:||:|||.||......::||||||||||.|.|||..|...||:.||.|||
  Rat   528 FTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVASGLHRKSLCHAKPIALMAL 592

  Fly  1184 DLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIH 1248
            .::..|.  .|....|.|:|:|||:|:|...|||||:.||||||||:.|..||:.||.....||:
  Rat   593 KMMELSE--EVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRIN 655

  Fly  1249 MSQETRDRLDARGGYAIEPRG---LIDIKGKGMMNTFWLLGKKGFDKPLPAP 1297
            :|..|...|.....:...||.   |.|...|.:....:.|..:...|| |.|
  Rat   656 ISPTTYQLLKREDSFTFIPRSREELPDNFPKEIPGVCYFLELRTGPKP-PKP 706

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 91/191 (48%)
Gucy1a2NP_076446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
HNOB <157..268 CDD:285002
HNOBA 314..501 CDD:285003 11/37 (30%)
CYCc 483..672 CDD:214485 91/190 (48%)
Guanylate_cyc 512..696 CDD:278633 85/185 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.