DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and adcy3a

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:XP_009290286.1 Gene:adcy3a / 571825 ZFINID:ZDB-GENE-111027-6 Length:1119 Species:Danio rerio


Alignment Length:382 Identity:97/382 - (25%)
Similarity:169/382 - (44%) Gaps:87/382 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1060 NLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKL-----KMGLAVDPEEFS--------DVTI 1111
            ||||           :.::.|:||..:||..:|:::     |.....:.::|:        :|:|
Zfish   267 NLEE-----------QSQQQERLLLSILPKHIADEMLQDMKKEASQKEMQQFNTMYMYRHENVSI 320

  Fly  1112 YFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAE 1176
            .|:||||||.:::.||..::|.|||:|:..||.....|:..:::.:||.|..:.|||....|||.
Zfish   321 LFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAA 385

  Fly  1177 QIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMEST 1241
            ....|.|.::....  .|:......:.:|:|:|:|....||:|....:|.::...|..|::||:.
Zfish   386 CSIMMGLAMVEAIS--YVREKTQTDVDMRVGVHSGTVLGGVLGQKRWQYDVWSTDVTVANKMEAG 448

  Fly  1242 GSSWRIHMSQETRDRLDARGGYAIEPRGLID----IKGKGMMNTFWLLGKKGFDKPLPAPPPIGE 1302
            |...|:|:||.|.:.|  .|.:.:||....|    :|.:| :.|:.::..||         |:|:
Zfish   449 GIPGRVHISQNTLECL--HGEFDVEPGNGGDRCEYLKERG-IETYLVVLPKG---------PVGK 501

  Fly  1303 SHGLDESLIRNSITLKAQANKSRTSTNPSSSQSSSLAGESVEVKVEITPPTNADLASGTNLPNSY 1367
             :|:      |.:.|      |.||:|.:|....:....:..|....|.|.:.:           
Zfish   502 -NGI------NGVKL------SVTSSNGNSPLLINTTECNGSVHTACTTPEDPE----------- 542

  Fly  1368 SLDSNSTNTISPNATLCPEFPGKTTPSSTSPQS----RKLSELTPENLLNPNSFNRL 1420
            .||:...|         |.||        :|:.    |.|:|...:...|....|:|
Zfish   543 ELDTRVVN---------PSFP--------NPRRRLRLRDLAERVIDAQENEQELNKL 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 59/204 (29%)
adcy3aXP_009290286.1 AC_N <37..304 CDD:292831 11/47 (23%)
CYCc 273..468 CDD:214485 59/198 (30%)
Guanylate_cyc 310..492 CDD:278633 57/186 (31%)
CYCc 858..1075 CDD:214485
Guanylate_cyc 889..1096 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.