DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and adcy6a

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:XP_017209219.1 Gene:adcy6a / 570652 ZFINID:ZDB-GENE-060221-1 Length:1203 Species:Danio rerio


Alignment Length:299 Identity:83/299 - (27%)
Similarity:139/299 - (46%) Gaps:59/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1051 FQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEF--------- 1106
            ||....|......|.||..:|        |:||..:||..||.::|..:....|:.         
Zfish   345 FQETRGYIQARLHLQRENQQQ--------ERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQK 401

  Fly  1107 -SDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVK 1170
             .:|:|.|:||.|||::|:.|:..::|..||:|:..||...:..:..:::.:||.|..|||||..
Zfish   402 HDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEP 466

  Fly  1171 IPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTA 1235
            ..|||.....|.:|::.....  |:.:.||.:.:|:|:|:|....||:||...::.::.:.|..|
Zfish   467 RADHAHCCVEMGVDMIEAISL--VREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLA 529

  Fly  1236 SRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKG----------MMNTFWLLGKKGF 1290
            :.||:.|.:.|||:::.|...|:  |.|.:||       |.|          .:.||.:||....
Zfish   530 NHMEAGGKAGRIHITKATLQYLN--GDYEVEP-------GFGGERNAYLKENSIETFLVLGCSQK 585

  Fly  1291 DKPLPAPPPIGESHGLDESLIRNSITLKAQANKSRTSTN 1329
            .|              ||.      .:.|:..::||::|
Zfish   586 RK--------------DEK------AMMAKMQRTRTNSN 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 61/201 (30%)
adcy6aXP_017209219.1 AC_N <97..395 CDD:318454 16/57 (28%)
Guanylate_cyc 397..570 CDD:306677 56/183 (31%)
DUF1053 609..696 CDD:310728
Guanylate_cyc 1004..1197 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.