DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and adcy1b

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001161822.1 Gene:adcy1b / 569499 ZFINID:ZDB-GENE-100805-1 Length:1114 Species:Danio rerio


Alignment Length:353 Identity:99/353 - (28%)
Similarity:159/353 - (45%) Gaps:69/353 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1059 NNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEF---------SDVTIYFS 1114
            |.:||.:|     ::.|.:|.|:||..:||.:||.::|......||..         .:|:|.|:
Zfish   226 NCIEERLR-----MEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILFA 285

  Fly  1115 DIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIA 1179
            ||||.|::|:.|:..::|.|||:|:..||......:..:::.:||.|..||||.....|||....
Zfish   286 DIVGSTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCV 350

  Fly  1180 TMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSS 1244
            .|.||::...  .:|.....|.|.:|:|||||....||:||...:|.::.:.|..|:.||:.|..
Zfish   351 EMGLDMIDTI--TSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMMEAGGLP 413

  Fly  1245 WRIHMSQETRDRLDARGGYAIEP-----------------------------RGLI--DIKGKGM 1278
            .::|:::.|.:.|:  |.|.:||                             .|||  |||....
Zfish   414 GKVHITRSTLECLN--GDYEVEPGNGRERHAFLLKHDIETFFIVPPHRRKIFPGLILSDIKPAKK 476

  Fly  1279 M---NTFWLL-----GKKGFDKPLPAPPPIGESHGLDESLIRNSITLKAQANKSRTSTNPSSSQS 1335
            |   ...:||     .:|.|...:|....:....|....::|::    .:..::||.|..|:.||
Zfish   477 MKFKTVCYLLVQLMHCRKMFRAEIPFSNVMNCEDGDKRRVLRSA----PEKLRNRTPTAASAPQS 537

  Fly  1336 SSLAGESVE------VKVEITPPTNADL 1357
            |  .|..|.      ::...|....|||
Zfish   538 S--PGTRVNRYINRLIEARQTESDTADL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 66/200 (33%)
adcy1bNP_001161822.1 AC_N <128..270 CDD:292831 16/48 (33%)
CYCc 236..431 CDD:214485 65/198 (33%)
Guanylate_cyc 272..454 CDD:278633 56/185 (30%)
DUF1053 498..585 CDD:283888 16/72 (22%)
CYCc 806..1012 CDD:214485
Guanylate_cyc 839..1035 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.