DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and adcy5

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001165056.1 Gene:adcy5 / 562619 ZFINID:ZDB-GENE-081104-470 Length:1186 Species:Danio rerio


Alignment Length:392 Identity:96/392 - (24%)
Similarity:171/392 - (43%) Gaps:80/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1075 ERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEF----------SDVTIYFSDIVGFTTIAAHCSPV 1129
            |.::.|:||..:||..||.::|..:....|:.          .:|:|.|:||.|||::|:.|:..
Zfish   354 ENQQQERLLLSVLPRHVALEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQ 418

  Fly  1130 QVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNV 1194
            ::|..||:|:..||......:..:::.:||.|..|||||....|||.....|.:|::.....  |
Zfish   419 ELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISL--V 481

  Fly  1195 KHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDA 1259
            :.:.||.:.:|:|:|:|....||:||...::.::.:.|..|:.||:.|.:.|||:::.|.:.|: 
Zfish   482 REVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLN- 545

  Fly  1260 RGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIGESHGLDESLI-------RNSITL 1317
             |.|.:||       |.|.....:|                 :.|.::..||       :....:
Zfish   546 -GDYDVEP-------GSGGERNVYL-----------------KKHNIETYLIVGCSQKRKEEKAM 585

  Fly  1318 KAQANKSRTSTNPSSSQS-------SSLAGESVEVKVEITPPTNADLASGTNLPNSYSLDSNSTN 1375
            .|:.|:.||::...:|..       :.|...||..:::         ..|...|.    |.|:..
Zfish   586 IAKMNRQRTNSVTHNSTHWTDRPFYNHLNANSVSKEMK---------RMGFEDPK----DKNTQE 637

  Fly  1376 TISPNATLCPEFPGKTTPSSTSPQSRKLSELTPENLLNPNSFNRLPSSTGGSSSRLYKKIEEMMD 1440
            .::|...: .||.|:..      .:|.:..|..|::.......|.|.        |.||..:.:|
Zfish   638 NLNPEDEV-DEFLGRAI------DARSIDRLRSEHVKKFLLTFREPD--------LEKKYSKQVD 687

  Fly  1441 LS 1442
            .|
Zfish   688 SS 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 62/200 (31%)
adcy5NP_001165056.1 AC_N 1..388 CDD:292831 10/33 (30%)
CYCc 354..548 CDD:214485 61/197 (31%)
Guanylate_cyc 390..574 CDD:278633 60/211 (28%)
DUF1053 598..687 CDD:283888 20/116 (17%)
CYCc 961..1155 CDD:214485
Guanylate_cyc 987..1181 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.