DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and si:ch211-132f19.7

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:XP_688903.4 Gene:si:ch211-132f19.7 / 560410 ZFINID:ZDB-GENE-130530-619 Length:1183 Species:Danio rerio


Alignment Length:296 Identity:88/296 - (29%)
Similarity:141/296 - (47%) Gaps:33/296 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1024 MRPDFNSVYERFKMLNHGRKVNFVDTMFQMLEKY-SNNLEEL----------IRERTEQLDIERK 1077
            :|...||..:|.:.|........:..||.::..| |..||..          .|:..|.:...|:
Zfish   840 IRQHQNSQIQRSQYLRRKGISVLLMAMFVVVVLYNSRQLETTSRLDFLWRLQARQEVEDMKELRE 904

  Fly  1078 KTEQLLNRMLPSSVA----EKLKMGLAVDPEEFSDVTIYFSDIVGFTTI-----AAHCSPVQVVD 1133
            ..|.||..:||:.||    |:.:....:..|.:..|.:.|:.|.||:..     ..| ..|:.:.
Zfish   905 HNECLLYNILPAHVARHFLERDRNNEDLFSESYERVGVMFASIPGFSDYYEKKELIH-QDVECLR 968

  Fly  1134 LLNDLYTIFDATINA---YNVYKVETIGDAYMVVSGL-PVK--IPDHAEQIATMAL-DLLHQSGR 1191
            |||::...||..::.   .::.|::|||..||..||| |.|  ..|....::|:.| .|..|...
Zfish   969 LLNEIIADFDELLDEPYFQDIEKIKTIGSCYMAASGLSPEKQECEDEWAHLSTLVLFALAMQETL 1033

  Fly  1192 FNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDR 1256
            ..:.........||:|:..||..|||:|.|.|:|.::|.|||.||||:|||.|.||.:.:.| .|
Zfish  1034 KEINKRTSNDFWLRVGISHGPVVAGVIGATKPQYDIWGMTVNLASRMDSTGLSGRIQVPEAT-SR 1097

  Fly  1257 LDARGGYAIEPRGLIDIKG----KGMMNTFWLLGKK 1288
            :.|..|:.::.||.|.:||    :|.:.|:::..::
Zfish  1098 VLAEHGFMLQLRGEIYVKGVSERRGAVRTYFVSSRE 1133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 5/16 (31%)
CYCc 1074..1266 CDD:214485 68/207 (33%)
si:ch211-132f19.7XP_688903.4 AC_N <133..375 CDD:292831
CYCc 338..537 CDD:214485
Guanylate_cyc 381..559 CDD:278633
DUF1053 579..667 CDD:283888
CYCc 903..1103 CDD:214485 67/201 (33%)
Guanylate_cyc 932..1131 CDD:278633 66/200 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.