DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and gucy1b2

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:XP_685297.5 Gene:gucy1b2 / 557191 ZFINID:ZDB-GENE-130530-664 Length:757 Species:Danio rerio


Alignment Length:357 Identity:143/357 - (40%)
Similarity:197/357 - (55%) Gaps:45/357 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 SNNLE---ELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGF 1119
            ||.||   |.:|..:..|:||::|:|:||..|||:.||.:||.|..|:..||...||.|||:|.|
Zfish   413 SNQLERKKEELRILSRNLEIEKQKSEKLLYAMLPTHVANQLKEGKRVEAGEFKVCTILFSDVVTF 477

  Fly  1120 TTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALD 1184
            |.|.|.|.|:|:|::||.:|:.||...:.:|||||||||||||||.|:||....|||::|..||.
Zfish   478 TNICAACEPIQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVPTNTHAERVANFALG 542

  Fly  1185 LLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHM 1249
             :..:.|.....:.|.|:|:|:||||||..|||||..|||||||||||||||||||.|....||:
Zfish   543 -MRIAAREVTNPITGQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHV 606

  Fly  1250 SQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPI-----GESHGLDES 1309
            |..|...:..:|.:.:..||.|::||||:|.|::||  |...|   :...|     ||.....|.
Zfish   607 SPFTFSVIKDKGIFEMAERGEIEVKGKGLMRTYFLL--KNLQK---SDEQIMGLVDGEMCVYQED 666

  Fly  1310 LIRNSITLK---------------------AQANKSRTS-TNPSSSQSSSLAGESVEVKVEITPP 1352
            |...:..||                     |:...:.|| .:|||..|...:.:.: ::.:|||.
Zfish   667 LEEETDDLKEVSPEDMNAVLKVEEDAHKEVAENGNNHTSPPSPSSLHSDKSSSDHL-IQFDITPA 730

  Fly  1353 TNADLASGTNLPNSYSLDSNSTNTISPNATLC 1384
            .::        ||.:....|..::...|...|
Zfish   731 YDS--------PNDFKHLHNGHHSDGINTKFC 754

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 101/191 (53%)
gucy1b2XP_685297.5 HNOB 2..163 CDD:285002
CAF-1_p150 <166..277 CDD:288454
HNOBA 269..453 CDD:285003 18/39 (46%)
CYCc 432..618 CDD:214485 100/186 (54%)
Guanylate_cyc 459..642 CDD:278633 96/183 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.