DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and Adcy4

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_062158.2 Gene:Adcy4 / 54223 RGDID:2034 Length:1072 Species:Rattus norvegicus


Alignment Length:215 Identity:71/215 - (33%)
Similarity:116/215 - (53%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1071 QLDIERKKTEQLLNRMLPSSVAEKLK--------MGLAVDPEEFSD-----------VTIYFSDI 1116
            :||.|:|..|.||..:||:.:|.::|        .|.:..||..::           |::.::||
  Rat   215 RLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQSSRPENTNNFHSLYVKRHQGVSVLYADI 279

  Fly  1117 VGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATM 1181
            ||||.:|:.|||.::|.:||:|:..||.....:...:::.:||.|..|||||:.:||||.....|
  Rat   280 VGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRM 344

  Fly  1182 ALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWR 1246
            .||:.....:..|  ..||.:.:|:|:|:|....||:||...:|.::...|..|:.||:.|...|
  Rat   345 GLDMCRAIRKLRV--ATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGR 407

  Fly  1247 IHMSQETRDRLDARGGYAIE 1266
            :|::..|...|  .|.||:|
  Rat   408 VHITGATLALL--AGAYAVE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 68/210 (32%)
Adcy4NP_062158.2 AC_N <115..246 CDD:292831 11/30 (37%)
CYCc 219..422 CDD:214485 66/206 (32%)
Guanylate_cyc 264..430 CDD:278633 57/166 (34%)
DUF1053 479..580 CDD:283888
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..523
CYCc 824..1039 CDD:214485
Guanylate_cyc 861..1060 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.