DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and ACXB

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster


Alignment Length:355 Identity:94/355 - (26%)
Similarity:148/355 - (41%) Gaps:91/355 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 SVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEK 1094
            ::|.:.:......|:||             .:.:.::.:.:..||..|....||..:|||.|.|.
  Fly   792 TMYAKERQSEFNTKINF-------------KINQDLQGKQKAADITNKSIIILLTNILPSHVVEV 843

  Fly  1095 LKMGLA---VDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDL-----LNDLYTIFDATINAYNV 1151
            ....:|   :..|.:..|::.|:.::.|.           :||     |||:.|.||..:|||..
  Fly   844 YLDSVANHELYYENYKMVSVMFAMLINFQ-----------MDLPSLRVLNDIITEFDRLLNAYKE 897

  Fly  1152 Y----KVETIGDAYMVVSGLPVKIP------------------------------DHAEQ---IA 1179
            |    |::.:|..||...||...:.                              ||.|.   :.
  Fly   898 YYVVEKIKVVGCTYMAACGLDFTLAKSKFGSRTHASYSSELEQVLYRKESKGTENDHDEVAFIMT 962

  Fly  1180 TMALDLLHQSGRFNVKHLPGVPL-------QLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASR 1237
            |.||||:......| |...|.|.       ::.||:.||...|||||.:.|.|.::|:.||.|||
  Fly   963 TFALDLMRVLSVCN-KAYAGRPFDRALSTGEICIGISTGEIMAGVVGASQPHYDIWGNPVNMASR 1026

  Fly  1238 MESTGSSWRIHMSQETR---DRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPP 1299
            |||||....||::|||.   ::.|....|    ||:..:||:|.:.|:::    |.|..|...|.
  Fly  1027 MESTGLPGHIHVTQETANILEQFDIMCMY----RGMTFVKGRGEIPTYFV----GIDDNLKFLPS 1083

  Fly  1300 IGESHGLDESLIRNSITLKAQANKSRTSTN 1329
            ..:.:.:.:   |.||........||::|:
  Fly  1084 NVKKNNMSK---RFSILSSLVPVHSRSTTS 1110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 1/10 (10%)
CYCc 1074..1266 CDD:214485 73/246 (30%)
ACXBNP_620474.2 AC_N <36..276 CDD:292831
CYCc 249..459 CDD:214485
Nucleotidyl_cyc_III 298..484 CDD:299850
CYCc 825..1047 CDD:214485 70/233 (30%)
Nucleotidyl_cyc_III 853..1072 CDD:299850 69/234 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.