DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and ACXE

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster


Alignment Length:206 Identity:58/206 - (28%)
Similarity:103/206 - (50%) Gaps:29/206 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 RKKTEQLLNRMLPSSVAEKLK-----------------------MGLAVDPEEFSDVTIYFSDIV 1117
            |.:.:|||:.:||..::..|:                       |.:.:.|    ||:|.::|:|
  Fly   246 RLQEKQLLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAIQIHP----DVSILYADVV 306

  Fly  1118 GFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMA 1182
            .:|.:....:...:|.:|:|||..||.....|.|.:::.:||.|..|:||....||||.....:.
  Fly   307 NYTHLTTTLTVEMLVKVLHDLYGRFDLAAYRYKVQRIKFLGDCYYCVAGLSDPDPDHANNCVILG 371

  Fly  1183 LDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRI 1247
            |.:::..  ..|:.:.|:.:.:|||:|:|...|||:|....::.::|..|..|:.:||||....:
  Fly   372 LSMINHI--MEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLDVTIANVLESTGVPGCV 434

  Fly  1248 HMSQETRDRLD 1258
            |:|..|.:.||
  Fly   435 HISGATLNNLD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 58/206 (28%)
ACXENP_652601.3 AC_N <31..272 CDD:318454 7/25 (28%)
Nucleotidyl_cyc_III 290..459 CDD:325147 51/162 (31%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.