DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and Gyc89Db

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:244 Identity:93/244 - (38%)
Similarity:143/244 - (58%) Gaps:18/244 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1047 VDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTI 1111
            ::.||:..|:.|:.||:.:    |..|..:::.::||..|:|..:||:::.......:.|.:|::
  Fly   435 LEIMFEKEEQRSDELEKSL----ELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSV 495

  Fly  1112 YFSDIV-----GFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKI 1171
            .|.:::     |...|.   ..:|.|..||.:::..|..|.:..||||||:|..||.|||.|...
  Fly   496 IFIEVMNIYDSGSNNIQ---DAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN 557

  Fly  1172 PDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTAS 1236
            |.|||....:||.::.   :.....||||  .:|:|:::||..|||||:.:||||||||||||||
  Fly   558 PLHAEHACDLALRVMK---KVKAHALPGV--AIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTAS 617

  Fly  1237 RMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLL 1285
            ||||:...|.|.:|..|..::. :.||.:|.||.:.:||||.|.|:|||
  Fly   618 RMESSSDPWMIQLSNYTALKVQ-KVGYKVEARGFVKVKGKGEMETYWLL 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 73/196 (37%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 14/47 (30%)
Nucleotidyl_cyc_III 488..665 CDD:416391 77/185 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.