DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and CG33958

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster


Alignment Length:237 Identity:129/237 - (54%)
Similarity:167/237 - (70%) Gaps:5/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1054 LEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVG 1118
            ::.|:.||.    ::.::|..|::|::.||.:|||.|||.:||....|..|.:..||||||||||
  Fly   442 IQLYALNLS----QKAKELKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVG 502

  Fly  1119 FTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPD-HAEQIATMA 1182
            ||.|||.|:|::||..||.:|.:||..|..|:|||||||||:|||.||||||..: |..:|||||
  Fly   503 FTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMA 567

  Fly  1183 LDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRI 1247
            ||||..|..|.:.......:|:|.|:||||..||:||..|||||||||||||||||||||.:.:|
  Fly   568 LDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKI 632

  Fly  1248 HMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKG 1289
            |:::|..|.|...||:..|.|||||:||||:|:|:||..|.|
  Fly   633 HITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCKDG 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 109/192 (57%)
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 14/40 (35%)
CYCc 459..647 CDD:214485 107/187 (57%)
Guanylate_cyc 485..669 CDD:278633 109/183 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.