DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and ACXC

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_609593.1 Gene:ACXC / 34689 FlyBaseID:FBgn0040508 Length:1130 Species:Drosophila melanogaster


Alignment Length:341 Identity:83/341 - (24%)
Similarity:153/341 - (44%) Gaps:71/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1028 FNSVYERFKMLNHGRKVNFVDTMFQ--MLEKYSNNLEEL-IRERTEQLDIERKKTEQLLNRMLPS 1089
            ||.:...|:::|        |||.:  .|:::...:||. :|....|..|       ||:.:||.
  Fly   223 FNMMGIFFRIMN--------DTMVRASFLDRHQFIMEETWLRHALLQESI-------LLDSILPP 272

  Fly  1090 SVA----EKLKMGLAV---DPEEFS----------------DVTIYFSDIVGFTTIAAHCSPVQV 1131
            .:|    ||:|..:..   .|:.|.                ||:|.::|:|.:|.:....:...:
  Fly   273 QIAKPVQEKIKSKITQSENSPDRFQMGPRTTESFMAIQIHPDVSILYADVVNYTHLTTTLTVGNL 337

  Fly  1132 VDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKH 1196
            |.:|:|||..||...:.:.|.:::.:||.|..|:||....||||:...::.:.::  |....|:.
  Fly   338 VKVLHDLYGRFDIAASNFKVQRIKFLGDCYYCVAGLTTPDPDHAKCCVSLGISMI--SNIQEVRA 400

  Fly  1197 LPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARG 1261
            ..|:.:.:|||:|:|...||::|....::.::|..|..|:.:||||....:|:|..|...|:   
  Fly   401 ERGLDIDMRIGVHSGSLLAGIIGEAKLQFDIWGTDVEIANHLESTGEPGYVHVSGRTLSMLN--- 462

  Fly  1262 GYAIEPRGLIDIKGK---------GMMNTFWLLGKKGFDKPLPAPPPIGESHGLDESLIRNSITL 1317
                 |.....:.|.         ..::|:.|.|:...:..:.:   ||.        :|:|..|
  Fly   463 -----PADYTILSGTQKAQSDPVLQYIHTYLLTGQVARESFITS---IGG--------VRSSSVL 511

  Fly  1318 KAQANKSRTSTNPSSS 1333
            :.::.....|:.||.|
  Fly   512 EVKSIDRIRSSRPSQS 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 4/12 (33%)
CYCc 1074..1266 CDD:214485 57/214 (27%)
ACXCNP_609593.1 AC_N <33..285 CDD:292831 21/76 (28%)
CYCc 293..468 CDD:214485 49/184 (27%)
Nucleotidyl_cyc_III 307..466 CDD:299850 47/168 (28%)
CYCc 833..1060 CDD:214485
Nucleotidyl_cyc_III 861..1085 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.