DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and CG32305

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster


Alignment Length:308 Identity:83/308 - (26%)
Similarity:145/308 - (47%) Gaps:44/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 SVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRE----RTEQLDIERKKTEQLLNRMLPSS 1090
            ::..|::::       :.:.::|::.|..|.|.|.|..    ||.|.:|..:..:|..| ..|| 
  Fly   227 AILSRYQLV-------YQNIVYQLVMKKENGLLESILPRKMIRTLQEEICSRIEDQDKN-FTPS- 282

  Fly  1091 VAEKLKMGL-AVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKV 1154
                 |.|| .:..|.:.:|:|..:|:|.:|.:.......|:|::|:||:..||...|.....::
  Fly   283 -----KAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMRI 342

  Fly  1155 ETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVG 1219
            :.:||:|..|:|:|...|.||......||:::|.:.  .|.....:.:.||||:|:|...||::|
  Fly   343 KFLGDSYNCVAGIPNYFPAHASCCVDQALEMIHITQ--GVSSRRELDINLRIGVHSGEVFAGIIG 405

  Fly  1220 LTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLD-----ARGGYAIEPRGLIDIKGKGMM 1279
            .|..::.::...|:..:|:||:|....:|:||.|...||     ..|..|.:...::...|   :
  Fly   406 HTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDEHYIFREGTEAAKNDPILQQAG---I 467

  Fly  1280 NTFWLLGKKGFDKPLPAPPPIGESHGLDESLIRNSITLKAQANKSRTS 1327
            .||.:..:      ||.....||   ||:.|...||      |..|.|
  Fly   468 RTFLVSNR------LPDAVEPGE---LDDELSSASI------NSCRLS 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 1/10 (10%)
CYCc 1074..1266 CDD:214485 58/197 (29%)
CG32305NP_728725.2 CYCc 251..449 CDD:214485 62/206 (30%)
Nucleotidyl_cyc_III 292..445 CDD:299850 47/154 (31%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.