DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and GUCY1A2

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001243353.1 Gene:GUCY1A2 / 2977 HGNCID:4684 Length:763 Species:Homo sapiens


Alignment Length:260 Identity:102/260 - (39%)
Similarity:135/260 - (51%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1041 GRKVNFVDTMFQMLEKYSNNLEELIRERTEQ-LDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPE 1104
            |.:....|.:.:.::|....|     |||.| |:.|:|||..||..:.|..||::|..|..|...
Human   456 GEQAKAQDGLKKRMDKLKATL-----ERTHQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQAR 515

  Fly  1105 EFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPV 1169
            :|.|||:.||||||||.|.|.|:|:||:.:||:|||.||......::||||||||||.|.:||..
Human   516 KFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHR 580

  Fly  1170 KIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQ------------------------------- 1203
            |...||:.||.|||.::..|.  .|....|.|:|                               
Human   581 KSLCHAKPIALMALKMMELSE--EVLTPDGRPIQPQRSELLFSFPVSIQLVPDQHQSETDLGTEK 643

  Fly  1204 LRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPR 1268
            :|||:|:|...|||||:.||||||||:.|..||:.||.....||::|..|...|.....:...||
Human   644 MRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPR 708

  Fly  1269  1268
            Human   709  708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 102/260 (39%)
CYCc 1074..1266 CDD:214485 91/222 (41%)
GUCY1A2NP_001243353.1 HNOB <159..270 CDD:285002
HNOBA 316..503 CDD:285003 16/51 (31%)
CYCc 485..705 CDD:214485 91/221 (41%)
Guanylate_cyc 514..729 CDD:278633 81/197 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.