Sequence 1: | NP_001356914.1 | Gene: | CG34357 / 5740349 | FlyBaseID: | FBgn0085386 | Length: | 1689 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001243353.1 | Gene: | GUCY1A2 / 2977 | HGNCID: | 4684 | Length: | 763 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 102/260 - (39%) |
---|---|---|---|
Similarity: | 135/260 - (51%) | Gaps: | 39/260 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1041 GRKVNFVDTMFQMLEKYSNNLEELIRERTEQ-LDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPE 1104
Fly 1105 EFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPV 1169
Fly 1170 KIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQ------------------------------- 1203
Fly 1204 LRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPR 1268
Fly 1269 1268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34357 | NP_001356914.1 | PKc_like | 763..1041 | CDD:354810 | 102/260 (39%) |
CYCc | 1074..1266 | CDD:214485 | 91/222 (41%) | ||
GUCY1A2 | NP_001243353.1 | HNOB | <159..270 | CDD:285002 | |
HNOBA | 316..503 | CDD:285003 | 16/51 (31%) | ||
CYCc | 485..705 | CDD:214485 | 91/221 (41%) | ||
Guanylate_cyc | 514..729 | CDD:278633 | 81/197 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |