DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and Adcy10

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_766617.2 Gene:Adcy10 / 271639 MGIID:2660854 Length:1614 Species:Mus musculus


Alignment Length:308 Identity:68/308 - (22%)
Similarity:110/308 - (35%) Gaps:109/308 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   966 MQEVVVRGEPYC-------MLSLS--PEEIIVKIK--KPPPLIRPSVSKGAAPPEAINIMRQCWA 1019
            |.:|::  .|.|       |:.:.  |::..||:.  ||||.....           ....:|..
Mouse   184 MNDVIL--SPNCWQLCDRSMIEIERIPDQRAVKVSFLKPPPTFNFD-----------EFFTKCMG 235

  Fly  1020 EQPDMRPDFNSVYERFKMLNHGRKVNFV--------DTMFQM-LEKYSNNLEELIRERTEQLDIE 1075
                    |...|.      .|...||:        |...:: |:||   :.|:|.::     |:
Mouse   236 --------FMDYYP------SGDHKNFLRLACMLESDPELELSLQKY---VMEIILKQ-----ID 278

  Fly  1076 RKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYF----------SDIVGFTTIAAHCSPVQ 1130
            .|:....|:.:.|                    |||.|          .:::| :.|.|.|  |.
Mouse   279 DKQLRGYLSELRP--------------------VTIVFVNLMFKEQDKVEVIG-SAIQAAC--VH 320

  Fly  1131 VVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLP-VKIPD---HAEQIATMALDLLHQSGR 1191
            :..:|.    :|...||  .|:..:. |.:::.|.|.| .|.||   ||.:.|....|...|..:
Mouse   321 ITSVLK----VFRGQIN--KVFMFDK-GCSFLCVFGFPGEKAPDEITHALESAVDIFDFCSQVHK 378

  Fly  1192 FNVKHLPGVPLQLRIGLHTGPCCAGVVGLTM-PRYCLFGDTVNTASRM 1238
            ...         :.||:.:|....|:||.|: ..|.:.|..||.|:||
Mouse   379 IRT---------VSIGVASGIVFCGIVGHTVRHEYTVIGQKVNIAARM 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 15/85 (18%)
CYCc 1074..1266 CDD:214485 44/180 (24%)
Adcy10NP_766617.2 CHD 40..214 CDD:143636 6/31 (19%)
CHD 292..461 CDD:143636 40/145 (28%)
COG3899 485..>959 CDD:226415
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.