DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and Adcy2

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_705762.2 Gene:Adcy2 / 210044 MGIID:99676 Length:1095 Species:Mus musculus


Alignment Length:302 Identity:84/302 - (27%)
Similarity:152/302 - (50%) Gaps:55/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 YSNNLEELIRERTE-----------QLDIERKKTEQLLNRMLPSSVAEKL-----------KMGL 1099
            |..:|.||..::|.           :|:.|:::.|:||..:||:.:|.::           |.|.
Mouse   211 YHKHLMELALQQTYRDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQ 275

  Fly  1100 AVDPEEF--------SDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVET 1156
            ..:...|        ::|:|.::||||||.:|:.|||.::|.:||:|:..||.........:::.
Mouse   276 MENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKI 340

  Fly  1157 IGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLT 1221
            :||.|..|||||:.:|:||:....|.||:.....:  |:...||.:.:|:|:|:|....||:||.
Mouse   341 LGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKK--VRDATGVDINMRVGVHSGNVLCGVIGLQ 403

  Fly  1222 MPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKG--------- 1277
            ..:|.::...|..|:.||:.|...|:|:|..|.:.|:  |.|.:|       :|.|         
Mouse   404 KWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLN--GAYKVE-------EGDGEIRDPYLKQ 459

  Fly  1278 -MMNTFWLLGKKGFDKPLPAPPPI-GESHGLDESLIRNSITL 1317
             ::.|::::..||..:   :|..: ...|.||.:.:|.|:.:
Mouse   460 HLVKTYFVINPKGERR---SPQHLFRPRHTLDGAKMRASVRM 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 66/210 (31%)
Adcy2NP_705762.2 AC_N <37..264 CDD:292831 13/52 (25%)
CYCc 240..443 CDD:214485 65/206 (32%)
Guanylate_cyc 285..469 CDD:278633 60/194 (31%)
DUF1053 499..603 CDD:283888 84/302 (28%)
CYCc 852..1060 CDD:214485
Guanylate_cyc 882..1081 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.