DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and ADCY4

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:285 Identity:79/285 - (27%)
Similarity:135/285 - (47%) Gaps:53/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1021 QPDMRP----------------DFNSVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELIRERT 1069
            |||.||                :...||.: .::....:..|.:.:..:..:             
Human   163 QPDSRPALLPQLAANAVLFLCGNVAGVYHK-ALMERALRATFREALSSLHSR------------- 213

  Fly  1070 EQLDIERKKTEQLLNRMLPSSVAEKLK--------MGLAVDPEEFSD-----------VTIYFSD 1115
            .:||.|:|..|.||..:||:.:|.::|        .|....||..::           |::.::|
Human   214 RRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYAD 278

  Fly  1116 IVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIAT 1180
            |||||.:|:.|||.::|.:||:|:..||.....:...:::.:||.|..|||||:.:||||.....
Human   279 IVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVR 343

  Fly  1181 MALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSW 1245
            |.||:.....:  ::...||.:.:|:|:|:|....||:||...:|.::...|..|:.||:.|...
Human   344 MGLDMCRAIRK--LRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPG 406

  Fly  1246 RIHMSQETRDRLDARGGYAIEPRGL 1270
            |:|::..|...|  .|.||:|..|:
Human   407 RVHITGATLALL--AGAYAVEDAGM 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 7/35 (20%)
CYCc 1074..1266 CDD:214485 67/210 (32%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831 19/96 (20%)
CYCc 219..422 CDD:214485 65/206 (32%)
Guanylate_cyc 264..418 CDD:278633 51/155 (33%)
DUF1053 479..583 CDD:283888
CYCc 827..1042 CDD:214485
Guanylate_cyc 864..1063 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.