DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and gcy-36

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_510557.3 Gene:gcy-36 / 191657 WormBaseID:WBGene00001556 Length:675 Species:Caenorhabditis elegans


Alignment Length:249 Identity:110/249 - (44%)
Similarity:159/249 - (63%) Gaps:7/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1037 MLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAV 1101
            :||. ::::.|:...| ||..:..||.:.::    |::|:.||:.||..|||.|||::||.||:|
 Worm   383 LLNQ-QRLSDVEMNLQ-LEANNEQLENMAKD----LEVEKGKTDALLREMLPPSVAQQLKQGLSV 441

  Fly  1102 DPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSG 1166
            :..|:.:.|:.|:|:..|..|...|:|..:|.|||:|:|.||..|.....|||||:||:||.|.|
 Worm   442 EAREYEEATVMFTDVPTFQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAYKVETVGDSYMSVGG 506

  Fly  1167 LPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDT 1231
            :|..:.||.|.|..:||.::.:: |.....:...||.:|.|:|:||..|||||..||||||||||
 Worm   507 IPDLVDDHCEVICHLALGMVMEA-RTVCDPITNTPLHIRAGIHSGPVVAGVVGAKMPRYCLFGDT 570

  Fly  1232 VNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLL 1285
            |||:|||||.....|||.|:..:...::.|.:..||||.:.|||||.|||::||
 Worm   571 VNTSSRMESHSPIGRIHCSENAKKCAESTGRFEFEPRGRVQIKGKGEMNTYFLL 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 2/3 (67%)
CYCc 1074..1266 CDD:214485 87/191 (46%)
gcy-36NP_510557.3 HNOB 3..167 CDD:285002
HNOBA 217..435 CDD:285003 20/57 (35%)
CYCc 415..604 CDD:214485 87/189 (46%)
Guanylate_cyc 441..624 CDD:278633 84/183 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.