DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and acy-4

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 / 178949 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans


Alignment Length:299 Identity:94/299 - (31%)
Similarity:142/299 - (47%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1030 SVYERFKMLNHGRKVNFVDTMFQMLEKYSNNLEELI---------RERTEQLDIERK--KTEQLL 1083
            |.|..|.:|:         .:..:|..:|....|||         :...|||.::||  :...:|
 Worm   730 STYANFCVLS---------CLTLLLVVFSTRRSELISRYDFIWKLQALDEQLQMKRKHEQNRSVL 785

  Fly  1084 NRMLPSSVAEK-LKMGLAVDP---EEFSDVTIYFSDIVGFTTIAAHC----SPVQVVDLLNDLYT 1140
            ..:|||.||:. ::...:|..   |...:..|.|:.:..|......|    ..|:.:.|||::.:
 Worm   786 ENILPSHVAKHFVEDATSVSKLYHESRDNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIIS 850

  Fly  1141 IFDATINAY-------NVYKVETIGDAYMVVSGLPVK---IPDHAEQIATMALDLL--------H 1187
            .||..::..       .:.|::||...|||.|||..:   ...|.|.||..|.:||        |
 Worm   851 DFDQILDQILDREEFKKIEKIKTISTTYMVASGLAGRECGDNSHVEAIALFARELLVKLESTNIH 915

  Fly  1188 QSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQE 1252
            ....||          ||||::.||..|||:|...|.|.::|::||.||||:|.|.:.||.:::|
 Worm   916 SFNNFN----------LRIGINVGPVVAGVIGSDKPHYDIWGNSVNVASRMDSGGVAGRIQVTEE 970

  Fly  1253 TRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFD 1291
            .:..|:.. ||..|.||.|::||||||.||:||..:.||
 Worm   971 VKSILEPL-GYNFECRGQINVKGKGMMETFFLLPPEDFD 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 4/10 (40%)
CYCc 1074..1266 CDD:214485 66/219 (30%)
acy-4NP_504486.4 AC_N <50..291 CDD:292831
CYCc 260..451 CDD:214485
Guanylate_cyc 293..448 CDD:278633
CYCc 778..984 CDD:214485 64/216 (30%)
Guanylate_cyc 807..1003 CDD:278633 70/206 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.