DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and acy-3

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_497765.4 Gene:acy-3 / 175489 WormBaseID:WBGene00000070 Length:1243 Species:Caenorhabditis elegans


Alignment Length:299 Identity:67/299 - (22%)
Similarity:125/299 - (41%) Gaps:46/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1067 ERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAV-DP----EEFSDVTIYFSDIVGFTTIAAHC 1126
            |.....:.:..:..:||:..||..:..:.:..:.: .|    |.:|.|::.:..:|||.::.|.|
 Worm   182 EAESTAEFQSNRLNKLLSSFLPYHLINQARHQITLYKPHLYNETYSQVSVAYGRLVGFESVLAQC 246

  Fly  1127 SPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGR 1191
            |.:....:|.:|.:..:....:....:|.:.|  ...|..:|.....||.::...:::|......
 Worm   247 SSIDAARVLKELDSRIERLAASNGCTRVASEG--ITAVCSIPGIDSQHATKLCRFSMELETLINS 309

  Fly  1192 FNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDR 1256
            |  :...|..:.:.||:.:||..|||||::...|.:.|...:.|..|:|..:...:::|.|||..
 Worm   310 F--RDATGADVSVCIGIDSGPVTAGVVGVSKWHYDVIGSVFDNALLMQSNATEPGVYVSNETRRF 372

  Fly  1257 LDARGGYAIE--PRGLIDIKGKGMMNTFW-LLGKKGFDKPLPAPP--PIGESHGLD--------- 1307
            |.:.|.:.:|  |.|             | |.|.      ||:|.  |:.:...|.         
 Worm   373 LGSTGEFELEKCPIG-------------WKLYGH------LPSPELFPVNKRFSLVTVPQAVNRV 418

  Fly  1308 -ESLIRNSITLKAQ-ANKSRTSTNPSSSQSSSLAGESVE 1344
             :|::..:.|||.. .||.|  ....|.:...:..:.||
 Worm   419 LQSIVAMNPTLKTMGTNKKR--KGEKSQEKFDMQKKKVE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 45/196 (23%)
acy-3NP_497765.4 TctB 26..137 CDD:284693
CYCc 195..378 CDD:214485 44/186 (24%)
Nucleotidyl_cyc_III 221..382 CDD:299850 40/164 (24%)
CYCc 696..873 CDD:214485
Nucleotidyl_cyc_III 711..880 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.