DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and Adcy6

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:235 Identity:71/235 - (30%)
Similarity:122/235 - (51%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1072 LDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEF----------SDVTIYFSDIVGFTTIAAHC 1126
            |..|.::.|:||..:||..||.::|..:....|:.          .:|:|.|:||.|||::|:.|
Mouse   417 LQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQC 481

  Fly  1127 SPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGR 1191
            :..::|..||:|:..||......:..:::.:||.|..|||||....|||.....|.:|::.....
Mouse   482 TAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISL 546

  Fly  1192 FNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDR 1256
              |:.:.||.:.:|:|:|:|....||:||...::.::.:.|..|:.||:.|.:.|||:::.|...
Mouse   547 --VREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQY 609

  Fly  1257 LDARGGYAIEPRGLIDIKGKG----------MMNTFWLLG 1286
            |:  |.|.:||       |:|          .:.||.:||
Mouse   610 LN--GDYEVEP-------GRGGERNAYLKEQCIETFLILG 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 62/201 (31%)
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454 11/36 (31%)
Guanylate_cyc 456..640 CDD:306677 58/194 (30%)
DUF1053 668..754 CDD:368844
Guanylate_cyc 1056..1250 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.