DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and ADCY5

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens


Alignment Length:362 Identity:90/362 - (24%)
Similarity:163/362 - (45%) Gaps:73/362 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1075 ERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEF----------SDVTIYFSDIVGFTTIAAHCSPV 1129
            |.::.|:||..:||..||.::|..:....|:.          .:|:|.|:||.|||::|:.|:..
Human   424 ENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQ 488

  Fly  1130 QVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNV 1194
            ::|..||:|:..||......:..:::.:||.|..|||||....|||.....|.:|::.....  |
Human   489 ELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISL--V 551

  Fly  1195 KHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDA 1259
            :.:.||.:.:|:|:|:|....||:||...::.::.:.|..|:.||:.|.:.|||:::.|.:.|: 
Human   552 REVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLN- 615

  Fly  1260 RGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIGESHGLDESLI-------RNSITL 1317
             |.|.:||       |.|.....:|                 :.|.::..||       :....:
Human   616 -GDYEVEP-------GCGGERNAYL-----------------KEHSIETFLILRCTQKRKEEKAM 655

  Fly  1318 KAQANKSRTST---NPSSSQS-----SSLAGESVEVKVEITPPTNADLASGTNLPNSYSLDSNST 1374
            .|:.|:.||::   ||....:     :.|.|..|..:::         ..|...|.    |.|:.
Human   656 IAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMK---------RMGFEDPK----DKNAQ 707

  Fly  1375 NTISPNATLCPEFPGKTTPSSTSPQSRKLSELTPENL 1411
            .:.:|...: .||.|:..      .:|.:..|..|::
Human   708 ESANPEDEV-DEFLGRAI------DARSIDRLRSEHV 737

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 62/200 (31%)
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454 10/33 (30%)
Guanylate_cyc 460..633 CDD:306677 57/200 (29%)
DUF1053 668..760 CDD:399378 16/90 (18%)
Guanylate_cyc 1087..1281 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.