DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and ADCY1

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:242 Identity:76/242 - (31%)
Similarity:123/242 - (50%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1044 VNFVDTMFQMLEKYSNN---------LEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGL 1099
            ||......::|.:.|..         :|:.:|     |:.|.:|.|:||..:||.:||.::|...
Human   224 VNMYGVFVRILTERSQRKAFLQARSCIEDRLR-----LEDENEKQERLLMSLLPRNVAMEMKEDF 283

  Fly  1100 AVDPEEF---------SDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVE 1155
            ...||..         .:|:|.|:||||||.:|:.|:..::|.|||:|:..||......:..:::
Human   284 LKPPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIK 348

  Fly  1156 TIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGL 1220
            .:||.|..||||.....|||.....|.||::...  .:|.....|.|.:|:|||||....||:||
Human   349 ILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTI--TSVAEATEVDLNMRVGLHTGRVLCGVLGL 411

  Fly  1221 TMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEP 1267
            ...:|.::.:.|..|:.||:.|...::|:::.|...|:  |.|.:||
Human   412 RKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLN--GDYEVEP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 67/200 (34%)
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831 19/72 (26%)
CYCc 258..453 CDD:214485 66/198 (33%)
Guanylate_cyc 294..476 CDD:278633 57/167 (34%)
Interaction with calmodulin. /evidence=ECO:0000250 493..520
CYCc 826..1037 CDD:214485
Guanylate_cyc 859..1056 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.