DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and npr3

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:XP_004910476.1 Gene:npr3 / 100495974 XenbaseID:XB-GENE-1012470 Length:508 Species:Xenopus tropicalis


Alignment Length:281 Identity:49/281 - (17%)
Similarity:95/281 - (33%) Gaps:83/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   891 RNCVVDARWV-LKITDYG----LNSFYESQGLPP-------RTRSAKELLWTAPELLRNMKLHQH 943
            |||......| |...:.|    :::|.|::.:..       :.:....::..:.:.:||:.|..|
 Frog   179 RNCFFTLEGVHLAFKEEGYAMSIHNFDETKHVDAEEIVHSIQNKERVVIMCASSDTVRNIMLAAH 243

  Fly   944 HHQHGRIQLGTQLGDVYSFGIIMQEVVV-------RGEPYCMLSLSPEEIIVKIKKPPPLIRPSV 1001
            ..       |...||...|.|.:.....       ||:.|.:                     ..
 Frog   244 RQ-------GMTNGDYVFFNIELFNSSTYGNGSWKRGDKYDL---------------------EA 280

  Fly  1002 SKGAAPPEAINIMRQCWAEQPDMRPDFNSVYERFKM----------LNHGRKVN-FVDTMFQMLE 1055
            .:..:..:.:.::|       .::|:|    |:|.|          ||....|| ||:.....:.
 Frog   281 KQAYSSLQTVTLLR-------TVKPEF----EKFSMEVKSSVQKLGLNEDDYVNMFVEGFHDAII 334

  Fly  1056 KYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFT 1120
            .|:..|.||::....:.|.| |..:|:.||.......:   :.:..:.:.:.|          |:
 Frog   335 LYALALHELLKNGFSKKDGE-KLVQQMWNRTYEGIAGQ---VSIDANGDRYGD----------FS 385

  Fly  1121 TIAAHCSPVQVVDLLNDLYTI 1141
            .||.........:::.|.|.|
 Frog   386 VIAMTDKETGTQEVIGDYYGI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 28/178 (16%)
CYCc 1074..1266 CDD:214485 12/68 (18%)
npr3XP_004910476.1 PBP1_NPR_C 25..414 CDD:380609 49/281 (17%)
TM_EphA1 443..474 CDD:391457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.