DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and LOC100333871

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:XP_002666572.2 Gene:LOC100333871 / 100333871 -ID:- Length:243 Species:Danio rerio


Alignment Length:255 Identity:121/255 - (47%)
Similarity:156/255 - (61%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1086 MLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYN 1150
            |||..||:.|::|..:..:.:...|::||||||||.:::..:|.||||.||.|||.||..|:.::
Zfish     1 MLPKQVADDLRLGKPMQAQSYVSATVFFSDIVGFTQLSSTSTPYQVVDFLNKLYTTFDEIIDNHD 65

  Fly  1151 VYKVETIGDAYMVVSGLPVKIPD-HAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCC 1214
            ||||||||||||||||:|.:... ||.:||.|||||:.....|.:.|.|...||:|.|:|:||..
Zfish    66 VYKVETIGDAYMVVSGVPRENGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVV 130

  Fly  1215 AGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMM 1279
            |||||..||||||||||||||||||||..:.:|..|......|:..|||.:..|||:.:||||.|
Zfish   131 AGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEIGGYLLTCRGLLQVKGKGDM 195

  Fly  1280 NTFWLLGKKGFDKPLPAPPPIGESHGLDESLIRNSITLKAQANKSRTSTNP---SSSQSS 1336
            .|:||.||...|...||.....|               |.:|.|...|:.|   |||:::
Zfish   196 VTYWLEGKCSKDMKKPATQQESE---------------KPEAEKEDYSSIPGVLSSSENT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 96/180 (53%)
LOC100333871XP_002666572.2 CYCc 1..179 CDD:214485 94/177 (53%)
Guanylate_cyc 16..202 CDD:278633 100/185 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123766at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.