DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and gucy1b1

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:302 Identity:115/302 - (38%)
Similarity:167/302 - (55%) Gaps:29/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1008 PEAINIMRQCWAEQPDMRPDFNSVYERFKMLN----HGRKVNFVDTMFQMLEKYSNNLE-ELIRE 1067
            ||..||:..|   .|.:. :.:.:..|...|:    |....:.|....|..|:|....| |::.:
Zfish   314 PETENILFLC---SPSVM-NLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTD 374

  Fly  1068 RTEQ----LDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAA-HCS 1127
            |.:.    |:.|:|||::||..:||.|||.:|:....|..:.:.:|||.||.||||....: |.|
Zfish   375 RLQHTLRALEDEKKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHAS 439

  Fly  1128 ---PVQVVDLLNDLYTIF----DATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDL 1185
               .:::|:||||:||.|    |:..|.| ||||||:||.||.|||||.....||:.|..:|||:
Zfish   440 AEGAIKIVNLLNDIYTRFDILTDSRKNPY-VYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDM 503

  Fly  1186 LHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMS 1250
            :..:|:..|..   .|:|:.||:|||....||:|..||||||||:|||..||.|:||...:|::|
Zfish   504 MEIAGQVKVDE---DPVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVS 565

  Fly  1251 QETRDRL----DARGGYAIEPRGLIDIKGKGMMNTFWLLGKK 1288
            :.|...|    :|...:.:|.||.:.:|||......|.|.:|
Zfish   566 EYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWFLSRK 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 8/36 (22%)
CYCc 1074..1266 CDD:214485 89/203 (44%)
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 28/95 (29%)
CYCc 385..584 CDD:214485 89/202 (44%)
Guanylate_cyc 412..605 CDD:278633 84/196 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.