DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and adcy8

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001137224.1 Gene:adcy8 / 100148976 ZFINID:ZDB-GENE-070912-197 Length:1225 Species:Danio rerio


Alignment Length:391 Identity:114/391 - (29%)
Similarity:174/391 - (44%) Gaps:76/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1028 FNSVYERFKMLNHGRKVNFVDT---------MF--------QMLEKYSNNLEELIR----ERTEQ 1071
            :..::.|:..|...:..:|:.|         ||        |.|| |:..|:.|.|    |...:
Zfish   851 YTPLFIRYDTLTLNQSKSFLGTKETSLLLMAMFLLAVFYHGQQLE-YTARLDFLWRVQAKEEINE 914

  Fly  1072 LDIERKKTEQLLNRMLPSSVA----EKLKMGLAVDPEEFSDVTIYFSDIVGFTTIAAHC----SP 1128
            :...|:..|.:|..:|||.||    ||.:....:..:.:..|.:.|:.|.||....:..    ..
Zfish   915 MRELREHNENMLRNILPSHVARHFLEKDRDNEELYSQSYDTVGVMFASIPGFADFYSQTEMNNQG 979

  Fly  1129 VQVVDLLNDLYTIFDATINA---YNVYKVETIGDAYMVVSGL-PVKIP-----DHAEQIATMALD 1184
            |:.:.|||::...||..:..   .::.|::|||..||.|||| |.|..     .|...:|..|:.
Zfish   980 VECLRLLNEIIADFDELLGEERFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFAIA 1044

  Fly  1185 LLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHM 1249
            |.......| ||... ..|||||:..|...|||:|...|:|.::|.|||.||||:|||.|.:|.:
Zfish  1045 LNESIQEIN-KHSFN-NFQLRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGKIQL 1107

  Fly  1250 SQETRDRLDARGGYAIEPRGLIDIKG----KGMMNTFWLLGKKGFDKPLPAPPPIGESH------ 1304
            .:||...|:.| |:|.|.||.|.:||    :|.:.|.:::|:...:..:..|..:...:      
Zfish  1108 PEETYAILNER-GFAFEYRGEIYVKGISEQEGKIRTHFMIGRVQPNPLILQPRKLTGQYSLAAVV 1171

  Fly  1305 -GLDESLIR-----------NSITLKAQANKSRTSTNPSSSQSSSLAGESVEVKVEITPPTNADL 1357
             ||.:||.|           ||..:|...|: ||...|..|.:|         ..|:|  ..:||
Zfish  1172 LGLVQSLNRQKQKQILNENNNSGIMKGHYNR-RTLLAPGGSDTS---------HAEVT--DKSDL 1224

  Fly  1358 A 1358
            |
Zfish  1225 A 1225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 2/12 (17%)
CYCc 1074..1266 CDD:214485 71/208 (34%)
adcy8NP_001137224.1 AC_N <135..374 CDD:292831
CYCc 340..538 CDD:214485
Guanylate_cyc 379..563 CDD:278633
DUF1053 592..685 CDD:283888
CYCc 919..1123 CDD:214485 71/206 (34%)
Guanylate_cyc 948..1147 CDD:278633 69/201 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.