DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34357 and adcy7

DIOPT Version :9

Sequence 1:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster
Sequence 2:NP_001106549.1 Gene:adcy7 / 100127741 XenbaseID:XB-GENE-1005225 Length:1061 Species:Xenopus tropicalis


Alignment Length:377 Identity:95/377 - (25%)
Similarity:167/377 - (44%) Gaps:80/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1071 QLDIERKKTEQLLNRMLPSSVAEKLKMGLAVDPEEFSD------------------VTIYFSDIV 1117
            :|::::::.|.||..:||..::.::|:.:.....|.:|                  |:|.::|||
 Frog   220 KLELKKRQQESLLLSVLPVYISMEMKLAIQDRLTETNDNRQPDNNFHSLYVKRHQNVSILYADIV 284

  Fly  1118 GFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMA 1182
            |||.:|:.|||.::|.:||:|:..||.........:::.:||.|..||||||.:|::|:....|.
 Frog   285 GFTRLASDCSPKELVVMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPVSLPNNAKNCVKMG 349

  Fly  1183 LDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRI 1247
            ||:.....:  |:...|..:.:|:|:|:|....||:||...::.::...|:.|:||||.|...|:
 Frog   350 LDICEAIKQ--VREATGADINMRVGVHSGNVLCGVIGLRKWQFDVWSHDVSLANRMESAGLPGRV 412

  Fly  1248 HMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIGESHG------L 1306
            |:::.|...::  |.|.:|                                   |.||      |
 Frog   413 HITEATLKHMN--GAYDVE-----------------------------------EGHGELRDPYL 440

  Fly  1307 DESLIRNSITLKAQANKSRTSTNPSSSQSSSLAGESVEVKVEITPPTNAD--LAS-GTNLPNSY- 1367
            .|..|:..:.:..:|..||...|       .|....|...:::.|.....  |.| |...|.|: 
 Frog   441 KEMNIKTFLVIDPRAKNSRVKNN-------HLTRHRVNDGIKVRPSVRMTRYLESWGAARPFSHF 498

  Fly  1368 -SLDSNSTNTISPNATLCPEFP----GKTTPSSTS-PQSRKLSELTPENLLN 1413
             ..|::||...:.|....||.|    |:|..:..: .|.|...|...:.::|
 Frog   499 DQTDASSTEVPTVNGKPKPEIPLKGMGRTVKTERNVSQKRNQEEELHDRMMN 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810
CYCc 1074..1266 CDD:214485 62/209 (30%)
adcy7NP_001106549.1 AC_N <21..266 CDD:318454 9/45 (20%)
Guanylate_cyc 268..418 CDD:306677 51/151 (34%)
DUF1053 483..591 CDD:399378 18/68 (26%)
Guanylate_cyc 851..1048 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.