DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ay and CG8927

DIOPT Version :10

Sequence 1:NP_001097524.1 Gene:Cpr65Ay / 5740348 FlyBaseID:FBgn0085300 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:107 Identity:21/107 - (19%)
Similarity:38/107 - (35%) Gaps:35/107 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SASLEKGEREEK---LHFGFHTENGHQRNEAITYTVKPETVQDPKEVTTQKPVEYKGGYSFISAD 80
            |.::.|...|.:   :.:|:..::|..:.|.|           ..:..|      ||.|.::..|
  Fly   259 SQTIRKWREENEDGSITWGYENDDGSFKEELI-----------GTDCIT------KGTYGYVDPD 306

  Fly    81 G----YEYQVLYKAN-----------KNGFQPYVTAHKIKPD 107
            |    |.|:...|.:           :|||..|.....:.|:
  Fly   307 GNKREYHYETGIKCDPNNRNNEEELQENGFVNYEENRAVLPN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AyNP_001097524.1 Chitin_bind_4 33..95 CDD:459790 14/76 (18%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 14/75 (19%)

Return to query results.
Submit another query.