DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ay and Lcp9

DIOPT Version :10

Sequence 1:NP_001097524.1 Gene:Cpr65Ay / 5740348 FlyBaseID:FBgn0085300 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster


Alignment Length:104 Identity:23/104 - (22%)
Similarity:42/104 - (40%) Gaps:29/104 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFLITALIALV---SSASLEKGEREEKL---HFGFHTENGHQRNEAITYTVKPETVQDPKEVTTQ 65
            |.::..|:|:|   ..|.:.|.:.|..|   ::.:...| |.|                 .|.|.
  Fly     4 VIVLACLLAVVFANEEADVVKSDSEVNLLDFNYAYELSN-HIR-----------------AVQTG 50

  Fly    66 KPVEY-----KGGYSFISADGYEYQVLYKANKNGFQPYV 99
            ...|:     .|.|.:::.:|...:|:|.|::.|:.|.|
  Fly    51 ALKEHDNWVVSGEYEYVAPNGKTVKVVYTADETGYHPKV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AyNP_001097524.1 Chitin_bind_4 33..95 CDD:459790 12/66 (18%)
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 12/68 (18%)

Return to query results.
Submit another query.