powered by:
Protein Alignment CG34291 and CG6503
DIOPT Version :9
Sequence 1: | NP_001097938.1 |
Gene: | CG34291 / 5740331 |
FlyBaseID: | FBgn0085320 |
Length: | 61 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189297.1 |
Gene: | CG6503 / 50079 |
FlyBaseID: | FBgn0040606 |
Length: | 62 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 20/56 - (35%) |
Similarity: | 35/56 - (62%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 SWLTIFILALIAMTVSAKSCPAPFKKEGNKCTAKRTIRGECPQNSQYQPSVNLCVY 59
:||.:.:|:::|...::..|||.:..|.|:||.:|.:.|.||..|.|..::|.||:
Fly 6 TWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGSSYSLNINKCVH 61
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2F1YY |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG26196 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.