DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34291 and CG6503

DIOPT Version :9

Sequence 1:NP_001097938.1 Gene:CG34291 / 5740331 FlyBaseID:FBgn0085320 Length:61 Species:Drosophila melanogaster
Sequence 2:NP_001189297.1 Gene:CG6503 / 50079 FlyBaseID:FBgn0040606 Length:62 Species:Drosophila melanogaster


Alignment Length:56 Identity:20/56 - (35%)
Similarity:35/56 - (62%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SWLTIFILALIAMTVSAKSCPAPFKKEGNKCTAKRTIRGECPQNSQYQPSVNLCVY 59
            :||.:.:|:::|...::..|||.:..|.|:||.:|.:.|.||..|.|..::|.||:
  Fly     6 TWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGSSYSLNINKCVH 61



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F1YY
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26196
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.