DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smal and Alk

DIOPT Version :9

Sequence 1:NP_723165.2 Gene:smal / 5740323 FlyBaseID:FBgn0085409 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster


Alignment Length:233 Identity:44/233 - (18%)
Similarity:77/233 - (33%) Gaps:105/233 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 NGSEYQANRNKPNGVGGSAGGL---GEGVAAAGGDIV-------GNNKY---------------- 480
            ||:  ..:|:...|.||..||.   |.|...||||:.       |.:.|                
  Fly   978 NGT--SVHRHGQGGFGGGGGGCNTGGGGGGYAGGDVYLTESNGEGGSSYISPSRSLREISEIHAG 1040

  Fly   481 -NNGPQLIAPRP----------------------------------------IDQEPNDANF--- 501
             ::||..|...|                                        |.:|...::|   
  Fly  1041 ASSGPGAIIIIPAIEGCGCDYRCVALDEFRSKVRCICPDGWSLKRDNHTACEIREEAGKSSFQYL 1105

  Fly   502 IGVVIVVLTTIIILLVAIILFIVSRTKRARGS-------------------NVLDAFQYSFNPN- 546
            :.::::.|..:.|.:.|:|..:.:|.:|.:.|                   |:.|:...:|||| 
  Fly  1106 VSILMISLAVLFICIAALIFMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNNFNPNY 1170

  Fly   547 ----TLGGNVDKHRPNGNSIKANVDDN----DSIGKNS 576
                .|.|::|.     ||:.....|:    :::||.:
  Fly  1171 GCDGILNGHIDV-----NSLPQVARDSLQLVNALGKGA 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smalNP_723165.2 FA58C 78..234 CDD:214572
FA58C 81..233 CDD:238014
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 3/18 (17%)
TyrKc 1193..1460 CDD:197581 2/11 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.