DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment smal and sev

DIOPT Version :9

Sequence 1:NP_723165.2 Gene:smal / 5740323 FlyBaseID:FBgn0085409 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_511114.2 Gene:sev / 32039 FlyBaseID:FBgn0003366 Length:2554 Species:Drosophila melanogaster


Alignment Length:394 Identity:84/394 - (21%)
Similarity:127/394 - (32%) Gaps:150/394 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   655 FPRPPTVPPP-------PMEKYYATTAIF-KPLKGPGSERSGCSSNTNTVSSGGGKSSHSHS--- 708
            |..|..:|||       |...::.:.|:. :.|..|.      |.....|...|..:|.|.|   
  Fly   744 FKHPLPLPPPSNGAGNGPASSHWQSFALLGRSLLLPD------SGQLILVEQQGQAASPSASWPL 802

  Fly   709 ---SHC--------------STGGPDHSGIYDDGIGTMNSKAT--APMINPYSSGNSS------- 747
               ..|              |.||..||  ....:|...:|.:  .|..|||.|.:::       
  Fly   803 KNLPDCWAVILLVPESQPLTSAGGKPHS--LKALLGAQAAKISWKEPERNPYQSADAARSWSYEL 865

  Fly   748 ---SAAAAAAAEFQRARTYNF---RSYPDNLXFEASLKL--VAAAPKRITAATASAGSTTMPKKP 804
               ..|:.:|...:..|...|   |..|||| ::..::.  |...|...|...|   :.|.|..|
  Fly   866 EVLDVASQSAFSIRNIRGPIFGLQRLQPDNL-YQLRVRAINVDGEPGEWTEPLA---ARTWPLGP 926

  Fly   805 QHLSLVASTAGGYGCGTSSKPKYSLTLHNSKLATGGKHLRDGLQ-QRQHLKAVDGVGLVPVPVTL 868
            ..|.. ||..|.             .:|.::|.       :||: |::.|:.:.|      |:|:
  Fly   927 HRLRW-ASRQGS-------------VIHTNELG-------EGLEVQQEQLERLPG------PMTM 964

  Fly   869 PVDEVVG--------------VHLKAG-------SEAGAATGE-----------ASGSVTRQMVE 901
             |:|.||              ||.:.|       ...|:.|.:           |...|.|....
  Fly   965 -VNESVGYYVTGDGLLHCINLVHSQWGCPISEPLQHVGSVTYDWRGGRVYWTDLARNCVVRMDPW 1028

  Fly   902 SGS-------------------------------SGSGKDGA-KCGNDNELGGGVANGVMRTQNN 934
            |||                               .||..|.| .....|.|.|.:|:.|:.||.:
  Fly  1029 SGSRELLPVFEANFLALDPRQGHLYYATSSQLSRHGSTPDEAVTYYRVNGLEGSIASFVLDTQQD 1093

  Fly   935 RLWY 938
            :|::
  Fly  1094 QLFW 1097

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smalNP_723165.2 FA58C 78..234 CDD:214572
FA58C 81..233 CDD:238014
sevNP_511114.2 fn3 439..520 CDD:278470
FN3 826..921 CDD:238020 23/100 (23%)
LY 993..1026 CDD:214531 5/32 (16%)
FN3 1292..1374 CDD:214495
FN3 1799..1897 CDD:238020
FN3 1993..2111 CDD:238020
Pkinase_Tyr 2209..2481 CDD:285015
PTKc_c-ros 2213..2483 CDD:270640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.